KEGG   Amphimedon queenslandica (sponge): 100638758Help
Entry
100638758         CDS       T02284                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100638758
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100638758
   04070 Phosphatidylinositol signaling system
    100638758
   04150 mTOR signaling pathway
    100638758
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100638758
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100638758
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100638758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1386 aa AA seqDB search
MSEPSILTVLLSLSSGETFEDIPVTDLEVTLGEFLDVSLKALEGDCKITLPETDSDLIDT
QDFHVFSVDKSEEFSLSTQLKNISYISTASLKDPPTLFLESSIFRSAIEVDIDSRIKRRR
ETIGSSVKNSAPYPPVRSLSLSSKGMSSEHMIFLAGRKEYDNNMSQRMYGSTDVMSLSEG
TSSLNLPEESLQRVFSNSMSMIDETGSIQSYGSEASEVLSRKLGGKDGLHDSDAFSHGGE
SSQESEVQHPPRVYIRHSTCDEEQETVVKTSGVDDNNLLPTCEENTPPDTPAKQSSALRS
RKGSFNRTTFRAKRNGSTVISPQHTKVYGSIKLFVVDFDIVVANIILTMDIRGDNTVTQI
KQSLWRLLRDEGHVTQECDSLWDPEKFTLTYEMNSSVYELYDEQQIFQTTTVAQLWRQEK
RQKGQLSVVTKRAESKEEKTLNMAISSMIGIGLYQLQFANNDELDITRRKMVAERQKAVQ
QRDPAMYSMEVEVQFTPLPPHVKAMIGEENKLLVKVYYESGASQTFQVDVNTVADDFLPT
VFPTEPHKRKRLGLPEHCNISDYVLKVAGRSSFIHGNFELIDFSPIVKALSKRRDIVLAL
VRRSDPKDDLPQHFPDWDLIDESTGLTGTHEELSALGKEHSQVFTMSMWDLQHKFRVRIL
GLDNLRDCSPDFDVIYVDVAVFHGGEELCRTLSTHEITACKYPRWNQWLVFNIAVKNLPK
AARLCFAVSGGVRRNDSRKRSSTWSKKDFVKQNTLRGDNIQADRPLHWVNMQILDHRALL
RQGVLRLNLWPYSTSGGEGRWGGMSPVGSTAVNPDGNTAAVLFIELDTYLHPVACPTEGW
GDEEISQVNQPHKESSPFRSELEKSISSDPLANLDKVEKELLWKFRYQLTNSPEALPKFL
QCVDWASLEQVTETHKLLQLWSPITMEVGLELLDYHFADEKVRTMAVARLSRLTNDEVLV
FLLQLVQVLKFEPYHDSALARFLLKRALLSKRIGHFFFWYLRSEMDSPQFSQRFGILLEA
FLKGCGKNIFIELQKQHQAVQDIMSIASGLKKHMEKHKGSATDYAKADLSQQNLPEYFAP
PFDPSLRMGNLQVEKCRVMDSKKTPLWLEFMNMDPSSTTQKPIKVIAKHGDDLRQDMLTL
QMLTIMDSLWQSEGLDLYIIPYGCVATGNEMGMIEVVQDAETVAKIQLHHGGSFSTLKDE
PLYEWLKKKNPNPKHFEQAIERFVYSCAGYCVATYVLGIGDRHNDNIMLTVSGNLFHIDF
GHFLGNTKAFLGVNRDRAPFVLTPDFEYVLGKRTSENFKKFEEIAVRAYLIIRKNANLFI
NLFSMMKCTGIPELRSVEDLDYLKSVLVLGKNEEQAADHFRQQIQKCLRLQWSTQLSWLA
HNWVHR
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaccatccattctgaccgtgttgctctctttgagttcaggagagacatttgaa
gatataccagtgacagatttggaagtaacactgggtgaattccttgacgtttctctaaag
gcgttggaaggagattgtaaaataactttaccagaaactgatagtgacttaattgatact
caagactttcatgtcttttcagttgataaatcagaggaattttcactctctactcagctt
aagaatatttcctatataagcacagcttctctgaaagatccacctactttgttccttgaa
tcttccatttttcgctccgccattgaagttgacattgactctcgaatcaagagaagaaga
gaaacaattggtagtagtgtgaaaaatagtgctccctatcctcctgttcgttcactctcc
cttagttctaagggaatgagttcagagcatatgatatttcttgctggtaggaaggaatat
gacaataatatgtcacagcgcatgtatggttcaactgatgtaatgtctttaagtgaaggc
actagttcacttaatttgcctgaagaatctcttcaaagagttttttctaattctatgtca
atgattgacgaaactggttctattcagtcgtatggatcagaagcatctgaagttttgagt
aggaaacttggtggaaaagatggactacatgattctgatgcatttagtcatgggggtgaa
agcagtcaggaaagtgaagtacaacatcctccaagggtatacataagacatagcacatgt
gatgaagagcaagagacagttgtcaaaacttctggtgtggatgataataatcttttacct
acttgtgaagaaaacactcctcctgatactcctgcaaaacaatcgtcagcattacgttca
agaaaagggtcatttaatagaactacttttagagcgaaacgtaatggttcaactgtgatt
agcccacagcataccaaggtttatggtagcatcaaattgtttgttgttgattttgatata
gtggttgctaatatcattcttactatggatatcagaggtgataacactgttactcaaatc
aagcaatctctttggagactcctgagggatgaaggccatgttacccaagaatgtgattct
ctgtgggatcctgagaagtttaccctgacatatgaaatgaattctagtgtatatgagctg
tatgatgagcagcaaatatttcaaacaacaactgtggctcaactttggcgtcaggaaaaa
cgacagaaaggtcaactatctgtggtgacaaaaagagctgagagcaaggaagagaagacc
ttgaacatggccattagctcaatgattggcattggactctatcagctacagtttgctaat
aatgatgagctagatattactagaagaaagatggttgctgagcgtcagaaggctgttcag
cagcgagatccagctatgtattcaatggaagtagaagtccaatttactcctttgccacca
catgtgaaggctatgattggtgaagagaataagttgcttgtaaaagtttattatgaaagt
ggagcctctcagacgtttcaagtagatgtcaatacagttgctgatgactttttaccaacc
gtatttcccactgaaccacacaagagaaaaagattaggtttaccagagcattgcaacatc
agtgactatgttttgaaagttgctggaaggagctctttcattcatggaaattttgaactg
atagatttttcaccaattgtaaaagcactaagcaaacgacgggacatagtattagctctt
gtaagaaggtctgacccaaaggatgatctaccacagcatttccctgattgggacttgatt
gatgaatctactggactaactggtacacatgaagagttgtcagctcttggtaaagaacac
tctcaagtgtttacaatgtcaatgtgggatttacagcataaattcagagtgagaattttg
ggtcttgataatttacgggattgttctcctgattttgatgttatttatgttgatgtggct
gttttccatggtggtgaagaactttgccgaactctctctacacatgaaattactgcatgt
aaatatccccgttggaaccagtggctggtttttaatattgcagttaagaatttaccaaaa
gctgcaaggctctgttttgctgtcagtggtggagttcgtcgtaatgacagccgaaagcgt
tcaagtacttggagtaagaaggattttgtaaagcagaataccctcaggggagacaacatt
caagctgaccgcccacttcattgggttaacatgcaaatcctggatcacagagccttgtta
aggcaaggtgtgcttcgtcttaatctttggccttatagtacatctggtggtgagggacgt
tggggaggaatgtctcctgttggatctactgctgttaatcctgatggaaatacagcagct
gttctttttattgaattagatacatacctacatcctgttgcatgtcccactgagggttgg
ggagatgaagaaatcagtcaagttaatcagccccacaaagagagctctcctttcagaagt
gaacttgaaaagtcaatatcaagtgatcctttggctaatttagacaaggttgaaaaggag
ttattatggaagtttaggtatcagttgactaatagcccagaggctcttccaaaattcttg
caatgtgttgattgggctagtctagaacaagttactgaaactcataagctgttacagttg
tggtcacctattacaatggaagttggccttgagttattggattatcattttgcggatgag
aaggtacgaacaatggctgttgcaagattgtcgagactgactaatgatgaagtgttagtg
ttcttactgcaattagttcaggtactgaaatttgagccttatcatgatagtgcccttgct
agatttcttttaaagagggctcttttgagtaaacgaattggtcattttttcttctggtac
cttcgatctgagatggattctccacagttttcacaacggtttggtattttactggaagcc
tttttaaagggatgtggcaaaaatatattcattgaattgcagaaacaacatcaagctgta
caggatattatgtctattgcatcaggactgaagaaacatatggagaagcataaaggtagt
gctacagactatgctaaggctgatcttagtcagcaaaatttaccagaatattttgctcct
ccatttgatccaagtctacgaatgggaaatttacaagttgaaaagtgtcgcgttatggac
tcaaagaagacccctttgtggcttgaatttatgaatatggatccatcgtcgactacacag
aaacctattaaagtgatagctaaacatggtgatgacttgcgacaggacatgcttacattg
cagatgttaacaataatggactctttatggcaaagcgaagggcttgatttgtacatcatt
ccatatggttgtgttgcgactggaaatgaaatgggaatgattgaagttgtccaggatgct
gagactgttgctaagatacaacttcatcatggagggagtttttctactttgaaggatgag
ccattgtatgaatggttaaaaaagaagaatccaaaccctaaacattttgagcaagctatt
gagcgttttgtttattcttgtgctggctattgcgtggcaacttatgtccttggaattggt
gatcgtcataatgataacataatgttgactgtcagtggtaacttgtttcatattgatttt
ggacattttttgggcaatacaaaagcatttttgggagttaatcgtgacagagcccctttt
gttctgacacctgattttgaatatgttttaggcaaaaggacatcagaaaattttaagaaa
tttgaagaaattgctgttagagcatatcttatcattcggaaaaatgctaatctgttcatc
aacttattttctatgatgaaatgtacaggcattccagagctccgtagtgtggaagattta
gattatttaaagagtgtacttgtgcttggaaagaatgaagagcaagctgctgatcatttt
cgacaacagattcaaaaatgtttaaggttgcagtggagcactcaattgagttggttagcc
cataactgggttcatcgataa

DBGET integrated database retrieval system