KEGG   Amphimedon queenslandica (sponge): 100638758Help
Entry
100638758         CDS       T02284                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform-like
  KO
K21289  
phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Inositol phosphate metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100638758
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100638758
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100638758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1386 aa AA seqDB search
MSEPSILTVLLSLSSGETFEDIPVTDLEVTLGEFLDVSLKALEGDCKITLPETDSDLIDT
QDFHVFSVDKSEEFSLSTQLKNISYISTASLKDPPTLFLESSIFRSAIEVDIDSRIKRRR
ETIGSSVKNSAPYPPVRSLSLSSKGMSSEHMIFLAGRKEYDNNMSQRMYGSTDVMSLSEG
TSSLNLPEESLQRVFSNSMSMIDETGSIQSYGSEASEVLSRKLGGKDGLHDSDAFSHGGE
SSQESEVQHPPRVYIRHSTCDEEQETVVKTSGVDDNNLLPTCEENTPPDTPAKQSSALRS
RKGSFNRTTFRAKRNGSTVISPQHTKVYGSIKLFVVDFDIVVANIILTMDIRGDNTVTQI
KQSLWRLLRDEGHVTQECDSLWDPEKFTLTYEMNSSVYELYDEQQIFQTTTVAQLWRQEK
RQKGQLSVVTKRAESKEEKTLNMAISSMIGIGLYQLQFANNDELDITRRKMVAERQKAVQ
QRDPAMYSMEVEVQFTPLPPHVKAMIGEENKLLVKVYYESGASQTFQVDVNTVADDFLPT
VFPTEPHKRKRLGLPEHCNISDYVLKVAGRSSFIHGNFELIDFSPIVKALSKRRDIVLAL
VRRSDPKDDLPQHFPDWDLIDESTGLTGTHEELSALGKEHSQVFTMSMWDLQHKFRVRIL
GLDNLRDCSPDFDVIYVDVAVFHGGEELCRTLSTHEITACKYPRWNQWLVFNIAVKNLPK
AARLCFAVSGGVRRNDSRKRSSTWSKKDFVKQNTLRGDNIQADRPLHWVNMQILDHRALL
RQGVLRLNLWPYSTSGGEGRWGGMSPVGSTAVNPDGNTAAVLFIELDTYLHPVACPTEGW
GDEEISQVNQPHKESSPFRSELEKSISSDPLANLDKVEKELLWKFRYQLTNSPEALPKFL
QCVDWASLEQVTETHKLLQLWSPITMEVGLELLDYHFADEKVRTMAVARLSRLTNDEVLV
FLLQLVQVLKFEPYHDSALARFLLKRALLSKRIGHFFFWYLRSEMDSPQFSQRFGILLEA
FLKGCGKNIFIELQKQHQAVQDIMSIASGLKKHMEKHKGSATDYAKADLSQQNLPEYFAP
PFDPSLRMGNLQVEKCRVMDSKKTPLWLEFMNMDPSSTTQKPIKVIAKHGDDLRQDMLTL
QMLTIMDSLWQSEGLDLYIIPYGCVATGNEMGMIEVVQDAETVAKIQLHHGGSFSTLKDE
PLYEWLKKKNPNPKHFEQAIERFVYSCAGYCVATYVLGIGDRHNDNIMLTVSGNLFHIDF
GHFLGNTKAFLGVNRDRAPFVLTPDFEYVLGKRTSENFKKFEEIAVRAYLIIRKNANLFI
NLFSMMKCTGIPELRSVEDLDYLKSVLVLGKNEEQAADHFRQQIQKCLRLQWSTQLSWLA
HNWVHR
NT seq 4161 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaaccatccattctgaccgtgttgctctctttgagttcaggagagacatttgaa
gatataccagtgacagatttggaagtaacactgggtgaattccttgacgtttctctaaag
gcgttggaaggagattgtaaaataactttaccagaaactgatagtgacttaattgatact
caagactttcatgtcttttcagttgataaatcagaggaattttcactctctactcagctt
aagaatatttcctatataagcacagcttctctgaaagatccacctactttgttccttgaa
tcttccatttttcgctccgccattgaagttgacattgactctcgaatcaagagaagaaga
gaaacaattggtagtagtgtgaaaaatagtgctccctatcctcctgttcgttcactctcc
cttagttctaagggaatgagttcagagcatatgatatttcttgctggtaggaaggaatat
gacaataatatgtcacagcgcatgtatggttcaactgatgtaatgtctttaagtgaaggc
actagttcacttaatttgcctgaagaatctcttcaaagagttttttctaattctatgtca
atgattgacgaaactggttctattcagtcgtatggatcagaagcatctgaagttttgagt
aggaaacttggtggaaaagatggactacatgattctgatgcatttagtcatgggggtgaa
agcagtcaggaaagtgaagtacaacatcctccaagggtatacataagacatagcacatgt
gatgaagagcaagagacagttgtcaaaacttctggtgtggatgataataatcttttacct
acttgtgaagaaaacactcctcctgatactcctgcaaaacaatcgtcagcattacgttca
agaaaagggtcatttaatagaactacttttagagcgaaacgtaatggttcaactgtgatt
agcccacagcataccaaggtttatggtagcatcaaattgtttgttgttgattttgatata
gtggttgctaatatcattcttactatggatatcagaggtgataacactgttactcaaatc
aagcaatctctttggagactcctgagggatgaaggccatgttacccaagaatgtgattct
ctgtgggatcctgagaagtttaccctgacatatgaaatgaattctagtgtatatgagctg
tatgatgagcagcaaatatttcaaacaacaactgtggctcaactttggcgtcaggaaaaa
cgacagaaaggtcaactatctgtggtgacaaaaagagctgagagcaaggaagagaagacc
ttgaacatggccattagctcaatgattggcattggactctatcagctacagtttgctaat
aatgatgagctagatattactagaagaaagatggttgctgagcgtcagaaggctgttcag
cagcgagatccagctatgtattcaatggaagtagaagtccaatttactcctttgccacca
catgtgaaggctatgattggtgaagagaataagttgcttgtaaaagtttattatgaaagt
ggagcctctcagacgtttcaagtagatgtcaatacagttgctgatgactttttaccaacc
gtatttcccactgaaccacacaagagaaaaagattaggtttaccagagcattgcaacatc
agtgactatgttttgaaagttgctggaaggagctctttcattcatggaaattttgaactg
atagatttttcaccaattgtaaaagcactaagcaaacgacgggacatagtattagctctt
gtaagaaggtctgacccaaaggatgatctaccacagcatttccctgattgggacttgatt
gatgaatctactggactaactggtacacatgaagagttgtcagctcttggtaaagaacac
tctcaagtgtttacaatgtcaatgtgggatttacagcataaattcagagtgagaattttg
ggtcttgataatttacgggattgttctcctgattttgatgttatttatgttgatgtggct
gttttccatggtggtgaagaactttgccgaactctctctacacatgaaattactgcatgt
aaatatccccgttggaaccagtggctggtttttaatattgcagttaagaatttaccaaaa
gctgcaaggctctgttttgctgtcagtggtggagttcgtcgtaatgacagccgaaagcgt
tcaagtacttggagtaagaaggattttgtaaagcagaataccctcaggggagacaacatt
caagctgaccgcccacttcattgggttaacatgcaaatcctggatcacagagccttgtta
aggcaaggtgtgcttcgtcttaatctttggccttatagtacatctggtggtgagggacgt
tggggaggaatgtctcctgttggatctactgctgttaatcctgatggaaatacagcagct
gttctttttattgaattagatacatacctacatcctgttgcatgtcccactgagggttgg
ggagatgaagaaatcagtcaagttaatcagccccacaaagagagctctcctttcagaagt
gaacttgaaaagtcaatatcaagtgatcctttggctaatttagacaaggttgaaaaggag
ttattatggaagtttaggtatcagttgactaatagcccagaggctcttccaaaattcttg
caatgtgttgattgggctagtctagaacaagttactgaaactcataagctgttacagttg
tggtcacctattacaatggaagttggccttgagttattggattatcattttgcggatgag
aaggtacgaacaatggctgttgcaagattgtcgagactgactaatgatgaagtgttagtg
ttcttactgcaattagttcaggtactgaaatttgagccttatcatgatagtgcccttgct
agatttcttttaaagagggctcttttgagtaaacgaattggtcattttttcttctggtac
cttcgatctgagatggattctccacagttttcacaacggtttggtattttactggaagcc
tttttaaagggatgtggcaaaaatatattcattgaattgcagaaacaacatcaagctgta
caggatattatgtctattgcatcaggactgaagaaacatatggagaagcataaaggtagt
gctacagactatgctaaggctgatcttagtcagcaaaatttaccagaatattttgctcct
ccatttgatccaagtctacgaatgggaaatttacaagttgaaaagtgtcgcgttatggac
tcaaagaagacccctttgtggcttgaatttatgaatatggatccatcgtcgactacacag
aaacctattaaagtgatagctaaacatggtgatgacttgcgacaggacatgcttacattg
cagatgttaacaataatggactctttatggcaaagcgaagggcttgatttgtacatcatt
ccatatggttgtgttgcgactggaaatgaaatgggaatgattgaagttgtccaggatgct
gagactgttgctaagatacaacttcatcatggagggagtttttctactttgaaggatgag
ccattgtatgaatggttaaaaaagaagaatccaaaccctaaacattttgagcaagctatt
gagcgttttgtttattcttgtgctggctattgcgtggcaacttatgtccttggaattggt
gatcgtcataatgataacataatgttgactgtcagtggtaacttgtttcatattgatttt
ggacattttttgggcaatacaaaagcatttttgggagttaatcgtgacagagcccctttt
gttctgacacctgattttgaatatgttttaggcaaaaggacatcagaaaattttaagaaa
tttgaagaaattgctgttagagcatatcttatcattcggaaaaatgctaatctgttcatc
aacttattttctatgatgaaatgtacaggcattccagagctccgtagtgtggaagattta
gattatttaaagagtgtacttgtgcttggaaagaatgaagagcaagctgctgatcatttt
cgacaacagattcaaaaatgtttaaggttgcagtggagcactcaattgagttggttagcc
cataactgggttcatcgataa

DBGET integrated database retrieval system