KEGG   Amphimedon queenslandica (sponge): 100638840Help
Entry
100638840         CDS       T02284                                 

Definition
(RefSeq) group XV phospholipase A2-like isoform X1
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Unknown
AA seq 408 aa AA seqDB search
MELSFLLILLTFLPVSQLARSPIVIGMCIRMVTLKCLIFLVPGLLGSKFEAKLNKPDSKA
PCMKTSDWYTLWVNITTIFPDHDKCLVDNLKLMYDEDNWYYNTEGIEIRVPGFGETDTIE
ELGVDVPYFHNFVEHFVKLGYTRGKDINGAPFDWRLAPDGLKRIRYYEALHQLIEDSYNR
NGQTPVTLVAHSLGGPVSLYFLSKYVSSDWKASRIKQFVSLSGVFGGTLKIILELISGDE
QNIIRARPLVLREALRSFPSSVFLLPSPALWGEDEAIVVQPKRNYTSRDYEELFTDISYT
NGSRIYNEVKDLISDFPPPNVTHYCYYGSDVHTHANLYYNSSFPDSQPVHIMPDNGDGTV
NERSLQSCRLWRDKQVFPVIEKSFVGVSHRNMVLNKEVLAAIEKLVLS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcctttctcttgattttactaacatttcttcctgtctctcagcttgcaaga
agccccattgtcattggtatgtgcattagaatggtcacactgaaatgtttaattttttta
gttcctggcctgcttggtagcaaatttgaagcaaagctcaacaaacctgatagtaaagca
ccctgtatgaagaccagtgattggtatacactctgggttaacataacaacgatttttcca
gatcatgataaatgcctggtagacaatctcaagttaatgtatgatgaagacaattggtat
tataatactgaaggaatcgagataagagtgcctggctttggtgaaactgatactattgaa
gaacttggagttgatgtaccctattttcataattttgtggagcactttgttaaactgggc
tacactagaggcaaagatataaatggagctccttttgattggcgtctagcaccagatggg
ctgaaaagaatcagatattacgaagctttgcatcagctaatagaggactcttacaatagg
aatggacagactcctgtcactcttgttgctcacagtttaggcggacctgtttctctttac
tttctaagcaagtacgtgtcctcagactggaaagcgtcccgaataaaacaatttgtttcg
ctctcgggagtttttggaggcactttaaaaataattttagaattaatttcaggagacgag
cagaacatcattcgtgcaaggccattggtgctaagagaggctttgagaagctttccaagt
tcagtatttctattgccctcaccagcgttatggggagaagatgaagcaatagtagtgcag
cctaaaagaaactacacgtcacgcgattatgaggaattgttcactgatatcagttatacc
aatggatcacgtatatacaatgaagtgaaggacctcatttctgatttccctcctcctaac
gtgacccattattgctactatggtagcgatgtccatactcatgccaacctttattacaac
agctcttttcctgattctcagccagttcatattatgcctgataatggagatgggacggtg
aatgagcgctcgcttcagtcttgtcgcttgtggagagataaacaggtttttccggtaata
gagaaatcatttgttggagtttcacatcggaatatggttttgaataaagaagtgcttgct
gctattgagaagttggttttgtcttaa

DBGET integrated database retrieval system