KEGG   Amphimedon queenslandica (sponge): 100638840Help
Entry
100638840         CDS       T02284                                 

Definition
(RefSeq) group XV phospholipase A2-like isoform X1
  KO
K00650  
lecithin-cholesterol acyltransferase [EC:2.3.1.43]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100638840
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.43  phosphatidylcholine---sterol O-acyltransferase
     100638840
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 408 aa AA seqDB search
MELSFLLILLTFLPVSQLARSPIVIGMCIRMVTLKCLIFLVPGLLGSKFEAKLNKPDSKA
PCMKTSDWYTLWVNITTIFPDHDKCLVDNLKLMYDEDNWYYNTEGIEIRVPGFGETDTIE
ELGVDVPYFHNFVEHFVKLGYTRGKDINGAPFDWRLAPDGLKRIRYYEALHQLIEDSYNR
NGQTPVTLVAHSLGGPVSLYFLSKYVSSDWKASRIKQFVSLSGVFGGTLKIILELISGDE
QNIIRARPLVLREALRSFPSSVFLLPSPALWGEDEAIVVQPKRNYTSRDYEELFTDISYT
NGSRIYNEVKDLISDFPPPNVTHYCYYGSDVHTHANLYYNSSFPDSQPVHIMPDNGDGTV
NERSLQSCRLWRDKQVFPVIEKSFVGVSHRNMVLNKEVLAAIEKLVLS
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcctttctcttgattttactaacatttcttcctgtctctcagcttgcaaga
agccccattgtcattggtatgtgcattagaatggtcacactgaaatgtttaattttttta
gttcctggcctgcttggtagcaaatttgaagcaaagctcaacaaacctgatagtaaagca
ccctgtatgaagaccagtgattggtatacactctgggttaacataacaacgatttttcca
gatcatgataaatgcctggtagacaatctcaagttaatgtatgatgaagacaattggtat
tataatactgaaggaatcgagataagagtgcctggctttggtgaaactgatactattgaa
gaacttggagttgatgtaccctattttcataattttgtggagcactttgttaaactgggc
tacactagaggcaaagatataaatggagctccttttgattggcgtctagcaccagatggg
ctgaaaagaatcagatattacgaagctttgcatcagctaatagaggactcttacaatagg
aatggacagactcctgtcactcttgttgctcacagtttaggcggacctgtttctctttac
tttctaagcaagtacgtgtcctcagactggaaagcgtcccgaataaaacaatttgtttcg
ctctcgggagtttttggaggcactttaaaaataattttagaattaatttcaggagacgag
cagaacatcattcgtgcaaggccattggtgctaagagaggctttgagaagctttccaagt
tcagtatttctattgccctcaccagcgttatggggagaagatgaagcaatagtagtgcag
cctaaaagaaactacacgtcacgcgattatgaggaattgttcactgatatcagttatacc
aatggatcacgtatatacaatgaagtgaaggacctcatttctgatttccctcctcctaac
gtgacccattattgctactatggtagcgatgtccatactcatgccaacctttattacaac
agctcttttcctgattctcagccagttcatattatgcctgataatggagatgggacggtg
aatgagcgctcgcttcagtcttgtcgcttgtggagagataaacaggtttttccggtaata
gagaaatcatttgttggagtttcacatcggaatatggttttgaataaagaagtgcttgct
gctattgagaagttggttttgtcttaa

DBGET integrated database retrieval system