KEGG   Amphimedon queenslandica (sponge): 100638840Help
Entry
100638840         CDS       T02284                                 

Definition
(RefSeq) group XV phospholipase A2-like
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 374 aa AA seqDB search
MELSFLLILLTFLPVSQLARSPIVIVPGLLGSKFEAKLNKPDSKAPYHDKCLVDNLKLMY
DEDNWYYNTEGIEIRVPGFGETDTIEELGVDVPYFHNFVEHFVKLGYTRGKDINGAPFDW
RLAPDGLKRIRYYEALHQLIEDSYNRNGQTPVTLVAHSLGGPVSLYFLSKYVSSDWKASR
IKQFVSLSGVFGGTLKIILELISGDEQNIIRARPLVLREALRSFPSSVFLLPSPALWGED
EAIVVQPKRNYTSRDYEELFTDISYTNGSRIYNEVKDLISDFPPPNVTHYCYYGSDVHTH
ANLYYNSSFPDSQPVHIMPDNGDGTVNERSLQSCRLWRDKQVFPVIEKSFVGVSHRNMVL
NKEVLAAIEKLVLS
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atggagctctcctttctcttgattttactaacatttcttcctgtctctcagcttgcaaga
agccccattgtcattgttcctggcctgcttggtagcaaatttgaagcaaagctcaacaaa
cctgatagtaaagcaccctatcatgataaatgcctggtagacaatctcaagttaatgtat
gatgaagacaattggtattataatactgaaggaatcgagataagagtgcctggctttggt
gaaactgatactattgaagaacttggagttgatgtaccctattttcataattttgtggag
cactttgttaaactgggctacactagaggcaaagatataaatggagctccttttgattgg
cgtctagcaccagatgggctgaaaagaatcagatattacgaagctttgcatcagctaata
gaggactcttacaataggaatggacagactcctgtcactcttgttgctcacagtttaggc
ggacctgtttctctttactttctaagcaagtacgtgtcctcagactggaaagcgtcccga
ataaaacaatttgtttcgctctcgggagtttttggaggcactttaaaaataattttagaa
ttaatttcaggagacgagcagaacatcattcgtgcaaggccattggtgctaagagaggct
ttgagaagctttccaagttcagtatttctattgccctcaccagcgttatggggagaagat
gaagcaatagtagtgcagcctaaaagaaactacacgtcacgcgattatgaggaattgttc
actgatatcagttataccaatggatcacgtatatacaatgaagtgaaggacctcatttct
gatttccctcctcctaacgtgacccattattgctactatggtagcgatgtccatactcat
gccaacctttattacaacagctcttttcctgattctcagccagttcatattatgcctgat
aatggagatgggacggtgaatgagcgctcgcttcagtcttgtcgcttgtggagagataaa
caggtttttccggtaatagagaaatcatttgttggagtttcacatcggaatatggttttg
aataaagaagtgcttgctgctattgagaagttggttttgtcttaa

DBGET integrated database retrieval system