KEGG   Amphimedon queenslandica (sponge): 100638947Help
Entry
100638947         CDS       T02284                                 

Definition
histone deacetylase 11-like
Orthology
K11418  
histone deacetylase 11 [EC:3.5.1.98]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100638947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 270 aa AA seqDB search
MGNSPTVPEDNSGEDSKLYIDVDRHKWPILYSPDYDISFWKLETIHPFDSTKWKRVYQLL
NEKNMLKGLEDIVQPNEASVSDLLVVHTQEYLESLKSSTNVAMVVEVPPLAIVPNYIVQN
KMLRPFRYQTGGTILAGKLAMERGWAINIGGGFHHCCSGEGGGFCAYADITLSIRFLFQR
VPDVKKVMIVDFDAHQGNGHERDFMDDDKVYIMDMYNRWIYPNDIKAKSAINMKIELDVH
TGDETYLRHIRRKLPEALDEFHPDIVVYNA
NT seq 811 nt NT seq  +upstreamnt  +downstreamnt
atgggaaactcaccaactgttcctgaagataattcgggtgaggactccaagctctacatt
gatgttgatcgacacaagtggcccatactgtactctcctgattatgatatttcattctgg
aagttagagactattcatccattcgacagtactaaatggaaacgagtgtatcaattattg
aatgaaaagaatatgttgaagggcctggaagatatagtgcaacctaatgaagcctcagta
agcgatctcctggttgttcatacacaagagtatttagagagtcttaagagtagtacaaat
gttgcaatggttgttgaagtaccccccctcgctattgtaccaaattatatagttcagaat
aaaatgctacgacctttccgatatcagacaggaggaacaattttggctggtaaactagca
atggaaagaggctgggccatcaacattggagggggattccatcactgttgcagtggagaa
ggagggggcttttgtgcatatgctgacattactctctctattaggtttctttttcaacgt
gttcctgatgtaaaaaaagtcatgatagtagactttgatgctcatcaaggcaatggacat
gaaagggactttatggatgatgataaagtgtacattatggacatgtacaatcgttggatt
tatcctaatgatattaaagcaaaatctgctattaatatgaaaattgaattggatgtacat
actggggatgaaacatacctccgtcacatcagaagaaaacttccagaagcccttgatgag
tttcatcctgacattgttgtttataatgctg

DBGET integrated database retrieval system