KEGG   Amphimedon queenslandica (sponge): 100638967Help
Entry
100638967         CDS       T02284                                 

Definition
(RefSeq) group XV phospholipase A2-like
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 397 aa AA seqDB search
MKMKVKSSFFFLLSVFLSVQALKSPIVIVPGLLGSQLEAKLDKDSSPNFLCSKKSDWFIL
WVELESAIPGVDECFVDNVKLRYDENTKEYYNASGVEVRVPGFGGTDTIEYLDKSYAASY
FNTFVKYFERMGYKKGRDLNGAPYDWRFAPDGLSKLGYYDALHQLIEDSYNRNGHTPVTL
IGHSLGGPTSLYFLINYASPDWKASRIKQFISLSGAFGGSVKIFLGLISGEKRFTSTGRS
LVTRYATRTFPSYPFLLPSYQLWKSDEVLVTQPKRNYTVHDYEDLFTDIKDPNGTRMYNE
VRNLVSSFPPPNVTHYCFYGTDVQTVAQIIYDSFPDQLPSKISHGNGDGTVNTRSLESCG
LWKDKQVFPVVMKSFSNVTHGEMVTDKNVLAEIEKLL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaggtgaagtcatctttctttttcctcttgtctgtgtttctctctgtacag
gcattaaagagcccaattgtaatagttcctggccttcttgggagtcaattggaggctaag
ctagacaaggattcctctccaaatttcttgtgcagcaaaaagagtgactggttcattctt
tgggttgaacttgagtcagccatccctggggttgatgaatgctttgtggacaatgtcaag
ctaaggtatgatgagaatacaaaagagtattacaatgcttctggtgttgaagtgagggtt
cctggttttggaggtactgatactattgagtatctcgataagtcctatgctgcttcgtat
ttcaatacttttgtgaaatattttgaaagaatgggatacaagaagggacgggatttaaac
ggtgccccttatgattggcgctttgcaccagatggactatcaaagcttggctactatgat
gccctgcatcagctaatagaagattcctataacaggaatggacacactccagtcactctc
atcggtcacagtctaggaggaccaacttcactttacttcttaatcaattatgcttctcct
gattggaaagcttctcgcattaagcagttcatttctctctctggagcctttggaggaagt
gttaagatatttcttggtttgatttcaggtgaaaaacgattcacttcaactggaagatct
ttagttacacgctatgcaactcggaccttcccaagttatccttttctgctaccctcgtat
cagctgtggaaatcagatgaggtcttagtgacacagcctaagagaaactacactgtgcac
gattatgaagatctctttactgatatcaaggatcctaatggaactcgcatgtataacgaa
gtcagaaacctcgtctctagttttcctcctcctaatgtcactcattattgtttttacggg
actgacgttcaaactgttgctcagataatctatgactcattcccagaccaactgccctca
aaaatttcacacgggaacggggatgggacggtgaatactcgttctcttgagtcctgtggt
ctgtggaaggacaagcaagtctttcctgttgtgatgaagtcgttttccaatgtgactcac
ggggagatggtcactgataaaaatgtgcttgcagagattgaaaaattgctataa

DBGET integrated database retrieval system