KEGG   Amphimedon queenslandica (sponge): 100638967Help
Entry
100638967         CDS       T02284                                 

Definition
group XV phospholipase A2-like
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100638967
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100638967
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100638967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 397 aa AA seqDB search
MKMKVKSSFFFLLSVFLSVQALKSPIVIVPGLLGSQLEAKLDKDSSPNFLCSKKSDWFIL
WVELESAIPGVDECFVDNVKLRYDENTKEYYNASGVEVRVPGFGGTDTIEYLDKSYAASY
FNTFVKYFERMGYKKGRDLNGAPYDWRFAPDGLSKLGYYDALHQLIEDSYNRNGHTPVTL
IGHSLGGPTSLYFLINYASPDWKASRIKQFISLSGAFGGSVKIFLGLISGEKRFTSTGRS
LVTRYATRTFPSYPFLLPSYQLWKSDEVLVTQPKRNYTVHDYEDLFTDIKDPNGTRMYNE
VRNLVSSFPPPNVTHYCFYGTDVQTVAQIIYDSFPDQLPSKISHGNGDGTVNTRSLESCG
LWKDKQVFPVVMKSFSNVTHGEMVTDKNVLAEIEKLL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgaaggtgaagtcatctttctttttcctcttgtctgtgtttctctctgtacag
gcattaaagagcccaattgtaatagttcctggccttcttgggagtcaattggaggctaag
ctagacaaggattcctctccaaatttcttgtgcagcaaaaagagtgactggttcattctt
tgggttgaacttgagtcagccatccctggggttgatgaatgctttgtggacaatgtcaag
ctaaggtatgatgagaatacaaaagagtattacaatgcttctggtgttgaagtgagggtt
cctggttttggaggtactgatactattgagtatctcgataagtcctatgctgcttcgtat
ttcaatacttttgtgaaatattttgaaagaatgggatacaagaagggacgggatttaaac
ggtgccccttatgattggcgctttgcaccagatggactatcaaagcttggctactatgat
gccctgcatcagctaatagaagattcctataacaggaatggacacactccagtcactctc
atcggtcacagtctaggaggaccaacttcactttacttcttaatcaattatgcttctcct
gattggaaagcttctcgcattaagcagttcatttctctctctggagcctttggaggaagt
gttaagatatttcttggtttgatttcaggtgaaaaacgattcacttcaactggaagatct
ttagttacacgctatgcaactcggaccttcccaagttatccttttctgctaccctcgtat
cagctgtggaaatcagatgaggtcttagtgacacagcctaagagaaactacactgtgcac
gattatgaagatctctttactgatatcaaggatcctaatggaactcgcatgtataacgaa
gtcagaaacctcgtctctagttttcctcctcctaatgtcactcattattgtttttacggg
actgacgttcaaactgttgctcagataatctatgactcattcccagaccaactgccctca
aaaatttcacacgggaacggggatgggacggtgaatactcgttctcttgagtcctgtggt
ctgtggaaggacaagcaagtctttcctgttgtgatgaagtcgttttccaatgtgactcac
ggggagatggtcactgataaaaatgtgcttgcagagattgaaaaattgctataa

DBGET integrated database retrieval system