KEGG   Amphimedon queenslandica (sponge): 100639143Help
Entry
100639143         CDS       T02284                                 

Definition
(RefSeq) alpha-galactosidase-like
  KO
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo and isoglobo series
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100639143
  Lipid metabolism
   00561 Glycerolipid metabolism
    100639143
   00600 Sphingolipid metabolism
    100639143
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    100639143
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100639143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 408 aa AA seqDB search
MWLSFLFLAIAATGAVLANNNGVGLKPPMGWNTWCSLGRCGRDYCDAKELMAIADAMATN
GMKEAGYEYINMDDCWGDHRDDKGNIVPDKDRFPDGLVPVVKYVNSKGFKFGLYTDAGLY
TCSSGGRKYKIPGSYGHYEQDANTYASWGIEYVKMDWCNTKINGTELDPHKQYQEMSDAL
NKTGKPIFFNSCEWGVDNPWEWMHQYANSWRTGPDHHDDWKTTSKIIEVNADLGDYAGTG
KGWNDPDFLMTGGEGCDPPVDSVHCPGMTDTEYRTEFTLWCLMSAPLLVVTDVRNMTSIM
KEVLLNKDLIEINQDTTGPGGKRIGFDKTCGENACQIWAKNITNGEKAIALYNADSVSHN
ITLDFSLFGWKVVSMQNLWKNENLNATNSYTVEVESHGVQAYRAASVG
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtggctcagcttcttgtttcttgctattgcagcaactggagctgtacttgctaataac
aatggagttggtctcaagccgccaatgggctggaacacctggtgctcactaggaaggtgt
ggccgagattactgtgatgccaaggagctgatggcaatagctgatgcaatggcgactaac
ggcatgaaagaagcaggctatgagtatattaatatggacgattgctggggcgatcatcgt
gatgacaagggtaatattgttcctgacaaagatcgctttcctgatggacttgttccggtt
gtgaaatacgtcaattcgaaaggattcaaatttggattatatactgatgcaggattgtac
acatgcagctctggtgggaggaagtacaaaataccaggaagctatggccattatgagcaa
gatgccaatacttatgctagctggggcattgaatatgtaaaaatggattggtgcaacaca
aagatcaatgggactgagctagacccacacaaacaatatcaagaaatgtctgatgcactt
aataaaactggaaagccgatattcttcaattcctgtgaatggggagtggacaatccttgg
gaatggatgcaccaatatgccaactcttggaggacagggcctgatcatcatgatgactgg
aaaacaacctcaaagataattgaagttaatgctgacctaggagactatgcaggcactggt
aagggctggaatgatccagatttcttaatgactggaggagaaggatgtgacccaccagtg
gattcagttcattgtcctgggatgactgacacagagtatcgtacagagttcactctttgg
tgtctgatgtcagctccattactagtagttactgatgtacgcaacatgaccagtataatg
aaggaagtgctgctcaataaagacttgatagagattaatcaggacactacagggccagga
ggtaaaagaataggatttgataaaacctgcggtgaaaatgcttgccaaatatgggcaaag
aatattaccaatggagagaaagctattgcactctacaatgctgatagtgttagtcataat
attacgctagattttagtttgttcggttggaaagttgtcagcatgcagaacctatggaag
aatgaaaatctaaatgctaccaacagttatactgttgaagtggagtctcatggagtacag
gcatacagagctgcttcagttggttga

DBGET integrated database retrieval system