KEGG   Amphimedon queenslandica (sponge): 100639143Help
Entry
100639143         CDS       T02284                                 

Definition
alpha-galactosidase-like
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Glycosphingolipid biosynthesis - globo series
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    100639143
  Lipid metabolism
   00561 Glycerolipid metabolism
    100639143
   00600 Sphingolipid metabolism
    100639143
  Glycan biosynthesis and metabolism
   00603 Glycosphingolipid biosynthesis - globo series
    100639143
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     100639143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 412 aa AA seqDB search
MAEIGEDKCLLVNTIAMWLSFLFLAIAATGAVLANNNGVGLKPPMGWNTWCSLGRCGRDY
CDAKELMAIADAMATNGMKEAGYEYINMDDCWGDHRDDKGNIVPDKDRFPDGLVPVVKYV
NSKGFKFGLYTDAGLYTCSSGGRKYKIPGSYGHYEQDANTYASWGIEYVKMDWCNTKING
TELDPHKQYQEMSDALNKTGKPIFFNSCEWGVDNPWEWMHQYANSWRTGPDHHDDWKTTS
KIIEVNADLGDYAGTGKGWNDPDFLMTHCPGMTDTEYRTEFTLWCLMSAPLLVVTDVRNM
TSIMKEVLLNKDLIEINQDTTGPGGKRIGFDKTCGENACQIWAKNITNGEKAIALYNADS
VSHNITLDFSLFGWKVVSMQNLWKNENLNATNSYTVEVESHGVQAYRAASVG
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggctgagattggagaagataaatgtttattagtaaatacaatagctatgtggctcagc
ttcttgtttcttgctattgcagcaactggagctgtacttgctaataacaatggagttggt
ctcaagccgccaatgggctggaacacctggtgctcactaggaaggtgtggccgagattac
tgtgatgccaaggagctgatggcaatagctgatgcaatggcgactaacggcatgaaagaa
gcaggctatgagtatattaatatggacgattgctggggcgatcatcgtgatgacaagggt
aatattgttcctgacaaagatcgctttcctgatggacttgttccggttgtgaaatacgtc
aattcgaaaggattcaaatttggattatatactgatgcaggattgtacacatgcagctct
ggtgggaggaagtacaaaataccaggaagctatggccattatgagcaagatgccaatact
tatgctagctggggcattgaatatgtaaaaatggattggtgcaacacaaagatcaatggg
actgagctagacccacacaaacaatatcaagaaatgtctgatgcacttaataaaactgga
aagccgatattcttcaattcctgtgaatggggagtggacaatccttgggaatggatgcac
caatatgccaactcttggaggacagggcctgatcatcatgatgactggaaaacaacctca
aagataattgaagttaatgctgacctaggagactatgcaggcactggtaagggctggaat
gatccagatttcttaatgactcattgtcctgggatgactgacacagagtatcgtacagag
ttcactctttggtgtctgatgtcagctccattactagtagttactgatgtacgcaacatg
accagtataatgaaggaagtgctgctcaataaagacttgatagagattaatcaggacact
acagggccaggaggtaaaagaataggatttgataaaacctgcggtgaaaatgcttgccaa
atatgggcaaagaatattaccaatggagagaaagctattgcactctacaatgctgatagt
gttagtcataatattacgctagattttagtttgttcggttggaaagttgtcagcatgcag
aacctatggaagaatgaaaatctaaatgctaccaacagttatactgttgaagtggagtct
catggagtacaggcatacagagctgcttcagttggttga

  All links  
No link information was found.   
DBGET integrated database retrieval system