KEGG   Amphimedon queenslandica (sponge): 100639147Help
Entry
100639147         CDS       T02284                                 

Definition
eukaryotic elongation factor 2 kinase-like
Orthology
K08292  
elongation factor 2 kinase [EC:2.7.11.20]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 564 aa AA seqDB search
MASILAKKHWEEAVKKVKSLEDPWEDIDFDSLPERVAIRHVYNPRSKSWWQDEVLIKMQE
KPFAFGAMRECYRMKKLSKFSVQPDWHNASNYVAKCYKSEESATALKQDVQLQMDAKLWG
EKYNKRNPPKKVDFFQAYLITLKEPLNGKTNYCVEHFMEGNYIKYNSNSGYISDVNRLTP
QAFSHFTFEKSGHQLIVVDIQGVGDLYTDPQIHTLDMKDYGEANLGDKGMALFFSSHLCS
PLCSALGLSSFDLHDKERVRLMSHSWEVSTTTVVTPIDNDEAVPKQLCSKRKSLSDVFER
VSLDLTAGSLSSPVIENKHISDDVFNDKSKETGSEATVTRLQENVKHRISSVALELMEGD
TIVESYSLEQKNVNLGQVHYEMAIYHSKGRFTSEPDLDASLFHLHKAADLCLGAALFELG
CIYRQLPHYELDCLSVEATPDNEAMGLKYLKSAAKTGLRQAMIVVGRILETGENSERDWK
EAAHWYTLALNSLKSESEVPLEDDYIIMAKLGNMYNTGKFGLSTDYEKAGQYFQEAADLA
MEEMKGKLANKYYMLAEEAWSCMD
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgattctggccaagaaacattgggaagaagctgtaaagaaagttaaatcctta
gaagatccttgggaagatatagattttgattctctccccgaaagagtggcaatccgacat
gtttataatcctagatcgaagtcatggtggcaagatgaagtgttgattaaaatgcaggaa
aaaccctttgcttttggtgctatgagggaatgctatagaatgaagaagttgtccaagttt
tcagtgcagcctgattggcacaatgcatcgaattatgttgctaagtgttataaaagtgaa
gaatctgcaactgctttgaaacaggatgttcaacttcagatggatgccaagttatgggga
gagaaatataacaaaagaaaccctccaaagaaagttgacttttttcaagcctatcttata
acactgaaggagccactgaatggcaagacaaattattgtgtcgaacattttatggaaggc
aattatattaaatacaactcaaatagtggctatatttcagatgttaacaggcttactcca
caggcattcagtcattttacgtttgaaaagtctggtcaccaactaattgttgttgatatt
caaggagtgggggatttatatactgacccacaaattcatacacttgacatgaaagactat
ggtgaggctaatcttggtgataaaggaatggcattattcttctcatctcatctctgctca
cctctctgctctgcacttggactatcttcttttgacctccatgacaaagaacgtgttaga
ttaatgtctcatagttgggaggtatccaccaccacagttgtcaccccaatagataatgat
gaagcagtaccaaagcaattatgtagtaaaaggaagagcctgtcggatgtttttgaaaga
gtttctttggatctaacagctggatcgctttctagtcctgtaattgaaaacaagcatatc
tctgatgatgtgtttaatgacaaatcaaaggagacagggagcgaagcaactgttactagg
ttgcaggaaaatgtgaagcacagaatatctagtgtggcattggaactgatggagggtgac
acaattgttgaatcatattcattggagcaaaagaatgtcaatctggggcaggtacactat
gaaatggcaatatatcactctaaaggaaggtttacttctgaacctgaccttgatgcgtca
ctgtttcatctacataaagcagcggacttgtgtttaggtgctgccttgtttgagttaggt
tgcatatataggcaactaccacactatgagctagactgtctttctgttgaggcaacacca
gataatgaagctatgggactgaaatatttgaagtctgcagccaagactggtctgagacaa
gcaatgattgttgttggaagaatactggagacaggagagaattcagagagggactggaaa
gaggctgcgcactggtacactctagcactgaactctcttaaaagtgaaagtgaagtgccg
ttagaagatgattatatcattatggccaaattgggaaacatgtacaatacaggtaaattt
gggctaagcactgactatgaaaaagctgggcagtattttcaagaagctgcagatctggca
atggaagaaatgaaggggaaattagctaataaatactacatgcttgctgaagaagcatgg
tcatgcatggactga

DBGET integrated database retrieval system