KEGG   Amphimedon queenslandica (sponge): 100639177Help
Entry
100639177         CDS       T02284                                 

Definition
protein disulfide-isomerase 2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aqu04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MKVLAFLCAVLLGAVVRADEDSLVLVLTKDTFHEAISSNENILVEFYAPWCGHCKALEPE
YNKAAKMIEEGGMDFTLAKVDATVEKELAEEYKVQGYPTIKFFKNGVPREYSGGRKANDI
IAWLEKSTGPVVTELATAAEIKAFNDKADVSIVGYFPSNETDEAKAYISAADSGIEGLNF
ALCINPETTKEMEAEVNTVVLYKKFDDGKSVFPAADSNWTTESIVRFISDERLPYVTLFS
DETAPIIFGGSIKNHLLSFFASDDEKYETYMENLKVIGKEFRGKVIVVHIDSKKEESERI
MEFFGITKDDLPAIRIIHLSEDMKKYRPDFQEIETEKLRGFVQGFLDGTITPHLNTEEVP
EDWDAKPVKVLVGKNFKEVALDETKHAFVEFYAPWCGHCKQLAPIWDKLGEHYKDNDQIV
IAKMDSTKNEVDGIQITGFPTIKFFPKGSKEGHDYVGGRTQEDLIQYVEDRLAGKPLEKG
EEVDEGMDTMEDDMNDDPAMPEEEEEDGATRDEL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctagcgtttctttgcgcagtgttacttggtgcagtggtaagagctgacgag
gactcacttgtcctggtcctcaccaaagatacttttcatgaagcaatttcctctaacgag
aacatcctagttgaattctatgctccatggtgtggacactgcaaagcgttggagccagaa
tacaacaaggcagctaagatgattgaggaaggaggcatggacttcactctagctaaagtt
gacgcaacagttgagaaggaactcgccgaagaatataaagtacaaggatacccaacaatc
aagttcttcaagaacggagtaccaagagaatatagtggtgggcgtaaagccaatgacatt
atcgcctggttggagaagagcactggtccagttgttactgaactggcaacagctgccgaa
attaaagccttcaatgataaagctgacgtctcaatcgttggatacttccctagcaacgag
actgacgaggccaaggcttacatttcagctgctgactccggtatagagggactcaacttt
gctctctgcatcaaccccgagacaacaaaagaaatggaagcagaagtgaacactgttgtc
ctttacaagaaatttgatgatggcaagtcagtattcccagctgctgacagtaactggact
actgagagtatcgtaagatttattagcgacgagagactaccatacgtcactctcttctct
gatgaaactgccccaattatttttggcggtagcattaagaatcacctcctgtcattcttt
gctagcgacgacgagaaatacgagacctatatggagaacctgaaagtaattggaaaggaa
ttccgtggaaaagttatagtagtacatattgattctaagaaggaggagtctgagagaatt
atggaattctttggaatcactaaagatgatcttccagctattcgtattatccacttaagc
gaagacatgaagaagtatcgtcctgatttccaagagatcgagactgagaagttgagggga
ttcgttcaagggtttcttgatggaacaataactcctcatttgaatactgaagaggtaccg
gaagattgggacgcaaaaccagtaaaagtcctcgttggaaagaactttaaggaagttgct
ttggacgagactaaacacgcctttgtagaattctatgccccatggtgtggtcactgcaag
cagttggctccaatttgggacaaacttggtgaacactacaaggacaatgatcagattgtc
atagctaaaatggactccaccaagaacgaagttgatggaattcagatcaccggtttccca
acaattaaattcttccctaaaggctcaaaagaaggacatgactacgttggtggaaggact
caagaagatctaattcaatacgttgaggacaggctggccggcaaaccgctagagaaagga
gaggaggtggatgagggcatggacacgatggaagatgacatgaatgatgatcctgccatg
ccagaggaggaggaggaagatggagccacaagagatgaactttag

DBGET integrated database retrieval system