KEGG   Amphimedon queenslandica (sponge): 100639177Help
Entry
100639177         CDS       T02284                                 

Definition
protein disulfide-isomerase 2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100639177
Enzymes [BR:aqu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100639177
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100639177
  Exosomal proteins of colorectal cancer cells
   100639177
  Exosomal proteins of bladder cancer cells
   100639177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 514 aa AA seqDB search
MKVLAFLCAVLLGAVVRADEDSLVLVLTKDTFHEAISSNENILVEFYAPWCGHCKALEPE
YNKAAKMIEEGGMDFTLAKVDATVEKELAEEYKVQGYPTIKFFKNGVPREYSGGRKANDI
IAWLEKSTGPVVTELATAAEIKAFNDKADVSIVGYFPSNETDEAKAYISAADSGIEGLNF
ALCINPETTKEMEAEVNTVVLYKKFDDGKSVFPAADSNWTTESIVRFISDERLPYVTLFS
DETAPIIFGGSIKNHLLSFFASDDEKYETYMENLKVIGKEFRGKVIVVHIDSKKEESERI
MEFFGITKDDLPAIRIIHLSEDMKKYRPDFQEIETEKLRGFVQGFLDGTITPHLNTEEVP
EDWDAKPVKVLVGKNFKEVALDETKHAFVEFYAPWCGHCKQLAPIWDKLGEHYKDNDQIV
IAKMDSTKNEVDGIQITGFPTIKFFPKGSKEGHDYVGGRTQEDLIQYVEDRLAGKPLEKG
EEVDEGMDTMEDDMNDDPAMPEEEEEDGATRDEL
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttctagcgtttctttgcgcagtgttacttggtgcagtggtaagagctgacgag
gactcacttgtcctggtcctcaccaaagatacttttcatgaagcaatttcctctaacgag
aacatcctagttgaattctatgctccatggtgtggacactgcaaagcgttggagccagaa
tacaacaaggcagctaagatgattgaggaaggaggcatggacttcactctagctaaagtt
gacgcaacagttgagaaggaactcgccgaagaatataaagtacaaggatacccaacaatc
aagttcttcaagaacggagtaccaagagaatatagtggtgggcgtaaagccaatgacatt
atcgcctggttggagaagagcactggtccagttgttactgaactggcaacagctgccgaa
attaaagccttcaatgataaagctgacgtctcaatcgttggatacttccctagcaacgag
actgacgaggccaaggcttacatttcagctgctgactccggtatagagggactcaacttt
gctctctgcatcaaccccgagacaacaaaagaaatggaagcagaagtgaacactgttgtc
ctttacaagaaatttgatgatggcaagtcagtattcccagctgctgacagtaactggact
actgagagtatcgtaagatttattagcgacgagagactaccatacgtcactctcttctct
gatgaaactgccccaattatttttggcggtagcattaagaatcacctcctgtcattcttt
gctagcgacgacgagaaatacgagacctatatggagaacctgaaagtaattggaaaggaa
ttccgtggaaaagttatagtagtacatattgattctaagaaggaggagtctgagagaatt
atggaattctttggaatcactaaagatgatcttccagctattcgtattatccacttaagc
gaagacatgaagaagtatcgtcctgatttccaagagatcgagactgagaagttgagggga
ttcgttcaagggtttcttgatggaacaataactcctcatttgaatactgaagaggtaccg
gaagattgggacgcaaaaccagtaaaagtcctcgttggaaagaactttaaggaagttgct
ttggacgagactaaacacgcctttgtagaattctatgccccatggtgtggtcactgcaag
cagttggctccaatttgggacaaacttggtgaacactacaaggacaatgatcagattgtc
atagctaaaatggactccaccaagaacgaagttgatggaattcagatcaccggtttccca
acaattaaattcttccctaaaggctcaaaagaaggacatgactacgttggtggaaggact
caagaagatctaattcaatacgttgaggacaggctggccggcaaaccgctagagaaagga
gaggaggtggatgagggcatggacacgatggaagatgacatgaatgatgatcctgccatg
ccagaggaggaggaggaagatggagccacaagagatgaactttag

  All links  
No link information was found.   
DBGET integrated database retrieval system