KEGG   Amphimedon queenslandica (sponge): 100639360Help
Entry
100639360         CDS       T02284                                 

Definition
tyrosine-protein phosphatase non-receptor type 7-like
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 326 aa AA seqDB search
MGHIAPLPRPNQVSRTSLVSRGHYQLDHLSKPMSVTELEHCLRYYGSLHDQYMSIPANMT
SMNEIPSGAQEKNRYCDVLPNPNSRVVLFLKFGIANSDYINANFIRGYRGQSKAYIATQG
PLPFTIADFWRMVWEQRTTVIIMTTGLVERNMAKCNQYWPDTHGYGVTETYGDIQVTVRK
KVNHNDYTLTTFLVQHLERHVTREVIHYWYTNWPDMGVPDNPSSVVDFLLETRRSRESFT
MPGPAVVHCSAGIGRTGVFIGADIGMRELEETQMIDVLRIVANMRQDRGGMVQTKDQYVF
LHKTLLQSTRLNFMITFITIISNLFI
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgggacacatagcaccactaccacgccctaaccaagtctcacgcaccagcttagtatca
agaggacactatcaacttgaccatctatcaaagccaatgtctgtaacagagctagagcat
tgccttcgttattatggaagtttacatgaccaatacatgtccattcctgctaatatgaca
agcatgaatgagatacctagtggagcccaggaaaagaaccgctactgtgacgtgctacca
aacccaaacagtcgcgttgtgctcttcctcaaatttggtatagctaactcggactatatc
aatgcaaatttcataagaggatacagaggacagtctaaagcctacattgcaacccagggc
ccactccccttcacaattgctgacttttggaggatggtatgggaacaaagaacaactgtt
atcatcatgacaaccggtcttgttgaaagaaacatggcaaaatgcaatcagtactggcct
gatactcatggatatggcgtgactgagacttatggtgacattcaagtgacagtgagaaag
aaagtcaatcataacgactacacattgactacattcctagtccaacatttagagcgtcac
gtaacgcgtgaagtgatacactactggtatactaattggcctgatatgggtgtgcctgat
aatccttcatctgtggttgatttcttactggagacaaggagaagcagggagtcttttaca
atgcctggaccagcagtagtacactgcagtgctggtatcggtcggacaggagtgttcata
ggagccgacattggtatgagggagctggaagaaacccaaatgattgatgtgcttagaatc
gttgccaacatgaggcaagacagaggcgggatggtccaaactaaagaccagtatgtgttc
ctgcacaagactttgctacaatctacaaggctcaatttcatgatcacttttattactatc
atcagtaacttatttatttaa

DBGET integrated database retrieval system