KEGG   Amphimedon queenslandica (sponge): 100639360Help
Entry
100639360         CDS       T02284                                 

Definition
(RefSeq) receptor-type tyrosine-protein phosphatase epsilon-like
  KO
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     100639360
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    100639360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 706 aa AA seqDB search
MKQLPALVFLLLAVAAMSQNSTNDTDTEEMLSVSSSLDFEMLTSMLPESIEPTSMINMSS
SVADLDQTDTPQNVTQIDQSSSIAYSSDIMSMAITDTTPKTSSAIQSLPPSDPSMPPSQS
MYLSQNMYSSQGMSSLETMYVSPSQGMPPSQSSISSINTSSVSSLLSTIPAAATSTPTLT
PSPTESLTSSSMYLPTSDDIFDFFSSSDDGAVIPTPSSAHSTTSKVVSQSSSSSLSVTSA
TINSTQSVTLSSSSVSSSLSVTSATIMSTQSSVSSESLGVSPPIPTSTPTESSTGIPVVV
WAPVGAGLGLLVIALVACMVIVGLVVLLRRRKRTKDKKKPRNYWESIHTNRHLGSAANVT
MGHIAPLPRPNQVSRTSLVSRGHYQLDHLSKPMSVTELEHCLRYYGSLHDQYMSIPANMT
SMNEIPSGAQEKNRYCDVLPNPNSRVVLFLKFGIANSDYINANFIRGYRGQSKAYIATQG
PLPFTIADFWRMVWEQRTTVIIMTTGLVERNMAKCNQYWPDTHGYGVTETYGDIQVTVRK
KVNHNDYTLTTFLVQHLERHVTREVIHYWYTNWPDMGVPDNPSSVVDFLLETRRSRESFT
MPGPAVVHCSAGIGRTGVFIGADIGMRELEETQMIDVLRIVANMRQDRGGMVQTKDQYVF
LHKILYEYAKRIGYVVPRIHGMNDFEEERYSENDLDDHIETTTTFV
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgaagcagctaccagcactggttttcctcctactggcagtagcggctatgtctcagaat
agcacaaacgacactgatacagaagaaatgttaagcgtatcgtcttctttagactttgag
atgttaacgtcaatgctgccagaatctattgagccaacatctatgataaacatgtcatct
tcagtagcagatctagatcaaacagatactcctcaaaatgtcactcaaatcgaccagtcc
agttctattgcgtacagctcagatataatgtcaatggcaattacagatacgacacccaag
acctcatcggccatccaatcattacctccatctgatccaagcatgcctccatcacaaagc
atgtatctttctcaaaacatgtattcttctcaaggaatgtcttctttagaaaccatgtac
gtgtctccttctcaaggcatgcctccttcacaaagctctattagctctatcaatacatca
tcagtgtcttcactactaagtaccattccagcagcagcaaccagtactccaacattaaca
ccatcacctactgaatctttgacctcatcttccatgtacttacccacaagtgatgacata
ttcgactttttttcaagtagcgatgatggtgctgtgatcccaacaccatcctcagcacat
tctacaacttcaaaagtagtttcacaatcctcttctagctctctctcggtaacatctgct
acaataaattccacacaatcagttacgctatcttcttcttcggtgtctagctctctttca
gtgacatctgctacaataatgtctacacaatcgtcagtctcttcagagtcattgggtgtt
tctccacctataccaacctcaactccaacagagtctagtacaggaataccagttgttgta
tgggcccctgttggagctgggctaggactgctagtcattgcactagttgcttgcatggtt
attgtgggtctggttgttcttcttagaaggagaaagagaacaaaagacaagaagaagcct
cggaattactgggagagtattcatacgaaccgtcaccttgggtctgctgccaatgtaaca
atgggacacatagcaccactaccacgccctaaccaagtctcacgcaccagcttagtatca
agaggacactatcaacttgaccatctatcaaagccaatgtctgtaacagagctagagcat
tgccttcgttattatggaagtttacatgaccaatacatgtccattcctgctaatatgaca
agcatgaatgagatacctagtggagcccaggaaaagaaccgctactgtgacgtgctacca
aacccaaacagtcgcgttgtgctcttcctcaaatttggtatagctaactcggactatatc
aatgcaaatttcataagaggatacagaggacagtctaaagcctacattgcaacccagggc
ccactccccttcacaattgctgacttttggaggatggtatgggaacaaagaacaactgtt
atcatcatgacaaccggtcttgttgaaagaaacatggcaaaatgcaatcagtactggcct
gatactcatggatatggcgtgactgagacttatggtgacattcaagtgacagtgagaaag
aaagtcaatcataacgactacacattgactacattcctagtccaacatttagagcgtcac
gtaacgcgtgaagtgatacactactggtatactaattggcctgatatgggtgtgcctgat
aatccttcatctgtggttgatttcttactggagacaaggagaagcagggagtcttttaca
atgcctggaccagcagtagtacactgcagtgctggtatcggtcggacaggagtgttcata
ggagccgacattggtatgagggagctggaagaaacccaaatgattgatgtgcttagaatc
gttgccaacatgaggcaagacagaggcgggatggtccaaactaaagaccagtatgtgttc
ctgcacaagattctctatgagtatgcaaagaggatcggttatgttgtaccaaggatacat
ggaatgaatgactttgaagaggaaagatattcagagaatgatttggacgatcatattgaa
acaacaaccacgtttgtttga

DBGET integrated database retrieval system