KEGG   Amphimedon queenslandica (sponge): 100639365Help
Entry
100639365         CDS       T02284                                 

Definition
NAD-dependent alcohol dehydrogenase-like
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    100639365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100639365
  Lipid metabolism
   00071 Fatty acid degradation
    100639365
  Amino acid metabolism
   00350 Tyrosine metabolism
    100639365
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100639365
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100639365
   00982 Drug metabolism - cytochrome P450
    100639365
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     100639365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 393 aa AA seqDB search
MAMFKQYIIVSPGQDIQCKEETLSKAIADLPPKGVLIKVHSSGVCHTDLHQWLEGGFRLS
DSEYLLFASREGMGYPKVPGHEISGTVYKFGPDVREDESSLSKGDSVIVYPWIACGDCRY
CERGNNDHCTGGKSQEIGMNINGGYSEFVIVPHYRYAVPLPSAISIDMGSVLGCSSLTVY
NAVKTGLAELPEAGDWRSDDQFHVAVVGLGGLGSWAVSFIPLLFKPAIKPNVAITGIDIN
ESKLSTFVDEGLIQNSFHLSTLKPPQEQASMCRDKISTKGYQIIFDFVNNPLTFDVSIRL
LGNHGVLVSVGLFGGTGNVQLPLLSLGRKKIIGIHTGSYNLFKEMLEFLASNIDNIKTPT
LSVYPLADCMKALRDVKEGKISGRAILKVNNET
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaatgtttaagcaatacattattgtatcacctggccaagatatccagtgtaaagaa
gaaaccctttctaaagcaattgcagatctgccaccaaaaggagtacttataaaggtccat
tcttctggagtgtgtcacactgaccttcatcaatggctggagggagggttccgcctctca
gactcagaatatttactgtttgctagtcgtgaagggatgggctatcctaaagtacctggt
catgagatatctggtactgtatataagtttggtcctgatgtaagggaagatgagagctca
ctcagtaaaggtgatagtgtgattgtctatccatggatagcttgcggggattgcaggtat
tgtgagagagggaacaatgatcattgcactggaggtaaatcacaagagattggtatgaac
attaatggagggtattctgagtttgtgatagttcctcattatcgctatgctgtcccttta
cccagtgctattagtattgacatggggtctgttcttggttgctctagtctaactgtctat
aatgctgtgaagactgggctggctgagctaccagaagctggagactggaggagtgatgat
cagttccatgttgctgtggttggattaggtgggttaggctcgtgggctgtctcattcatt
ccacttcttttcaagccagcaataaaacccaatgtagctataactggcattgatatcaat
gaatcaaaattaagcacctttgtagatgaaggtcttatacaaaactcattccacctctca
acattgaagcctccacaagaacaagccagtatgtgtcgggacaaaatatctacgaaaggc
tatcaaataatttttgactttgtgaataaccctctaacgtttgatgtctccattcgcctc
cttggtaatcatggggtactagtgtctgttgggctgtttggtgggacaggaaatgtccag
ctacctttgttgtcccttgggagaaaaaagataatcggtattcatacaggatcttacaat
ctcttcaaggaaatgcttgaatttcttgcctcaaatatagacaacattaagacacctacc
ctcagtgtttatccactagctgattgcatgaaagcattgagagacgttaaagaaggcaaa
atatctggccgagcaattttaaaagtaaacaatgagacataa

DBGET integrated database retrieval system