KEGG   Amphimedon queenslandica (sponge): 100639722Help
Entry
100639722         CDS       T02284                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100639722
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    100639722
Messenger RNA biogenesis [BR:aqu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     100639722
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     100639722
Translation factors [BR:aqu03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    100639722
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 184 aa AA seqDB search
MASKEPDKPSTSESEKSQAPLIASVPAVTPERHPLQNKWVLWYLKNDKQKEWKDNLRKII
CIDTVEDFWSVYNHIKPPSQISSGCDYMLFKEGIEPMWEDKTNKDGGRWLLNIDKRDRKD
GVLDNVWMETLMCLIGEIFDDSSDDICGAVAQNRTKGDKISIWTRVAKNKDHVHRIGYVI
KFFY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggaaccagacaaaccatcaacgagtgagagtgaaaagtctcaagctcca
ttaatagcgtctgtaccagcggtaacaccagaaagacatccattacagaacaagtgggtt
ttgtggtatttgaaaaatgacaagcaaaaagaatggaaagacaatttaagaaagatcatt
tgcattgatacggttgaagacttttggtctgtgtacaatcatatcaagccaccaagccaa
attagcagtgggtgtgactacatgctatttaaagaaggtattgaaccaatgtgggaagac
aaaacaaacaaagatggtggtaggtggttgttaaatattgataaaagagacagaaaagat
ggagttttagacaatgtttggatggagacattaatgtgcttgattggggaaatttttgat
gacagtagtgatgatatctgtggagctgtggcacagaatagaacaaaaggagacaaaata
tctatttggactagagttgcaaaaaataaagaccatgttcacagaatagggtacgttata
aaatttttctattaa

DBGET integrated database retrieval system