KEGG   Amphimedon queenslandica (sponge): 100639722Help
Entry
100639722         CDS       T02284                                 

Definition
eukaryotic translation initiation factor 4E-like
Orthology
K03259  
translation initiation factor 4E
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
mTOR signaling pathway
Class
Genetic Information Processing; Translation; RNA transport [PATH:aqu03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aqu04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 184 aa AA seqDB search
MASKEPDKPSTSESEKSQAPLIASVPAVTPERHPLQNKWVLWYLKNDKQKEWKDNLRKII
CIDTVEDFWSVYNHIKPPSQISSGCDYMLFKEGIEPMWEDKTNKDGGRWLLNIDKRDRKD
GVLDNVWMETLMCLIGEIFDDSSDDICGAVAQNRTKGDKISIWTRVAKNKDHVHRIGYVI
KFFY
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaaggaaccagacaaaccatcaacgagtgagagtgaaaagtctcaagctcca
ttaatagcgtctgtaccagcggtaacaccagaaagacatccattacagaacaagtgggtt
ttgtggtatttgaaaaatgacaagcaaaaagaatggaaagacaatttaagaaagatcatt
tgcattgatacggttgaagacttttggtctgtgtacaatcatatcaagccaccaagccaa
attagcagtgggtgtgactacatgctatttaaagaaggtattgaaccaatgtgggaagac
aaaacaaacaaagatggtggtaggtggttgttaaatattgataaaagagacagaaaagat
ggagttttagacaatgtttggatggagacattaatgtgcttgattggggaaatttttgat
gacagtagtgatgatatctgtggagctgtggcacagaatagaacaaaaggagacaaaata
tctatttggactagagttgcaaaaaataaagaccatgttcacagaatagggtacgttata
aaatttttctattaa

DBGET integrated database retrieval system