KEGG   Amphimedon queenslandica (sponge): 100639726Help
Entry
100639726         CDS       T02284                                 

Gene name
Usp47
Definition
ubiquitin specific peptidase 47
Orthology
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100639726 (Usp47)
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100639726 (Usp47)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1414 aa AA seqDB search
MATDSVDVVVSGEGEGGAAPAPPVTDEVFADSEPSLSGPLDTTEKSVELSTFSTSYRSNV
STATEGGVSFVVTDETNPTWQSSRFNFVLPLSTSIDSLHITVADHASYVNDSFLLIWRRQ
SEEGEEEIPLDHCSTATLLEMGMAEEPKKTYLLIRVKDDMQPTRVGNENITSEAEREAST
GQVSTQITGASSSSSGWSSYTNPIYNSNTYGSGGNTSNYSSSSGYGSYSYSYNAKSETGF
VGLVNQAMTCYLNSLLQTLYMTPEFRNALYQWRFESKAESEDQAVVEATKCIPYQLQRLF
LQLQTAKKRAVETTDVTKSFGWDSSEAWQQHDVQELCRVMFDALEKRFKKDQTQQVDLIN
DLYQGKCKDYVKCKECGYESAREDIFLDIPLVIKPFGRSETYGSVEEAMKAFVEPETLEG
DNQYHCTKCNTKRDALKGLKFKQFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPKVLDLN
DFIDEDDRPSVPNDVPEKYKTFVVERFDRPHDQPPSYSSITSSTLPSYSQATGGSNKADE
PDETDVAEKGDRPKPPDVASMLSHGPYVYELFSIMIHSGSAIGGHYYAYIKSFKDKRWYC
FNDQSVTRITQEEIEQTFGGSDRSSSRGYYSSMYSYSANAYMLMYRRIDTNENADFLQDD
QFPDHLKKQIEDDKEREANEKKKQEMEKQMCKFKLFCVHPVTGKMIESRFEIHQDTKLPQ
ALAEAYKTMKLAPHIPIERCRLVKYDDYSETMDQSFDLDEFQDQTFGQLVGGARNYYSFE
MFLETRKENEAFKKYNKGGMKLKIAVIDLSTGDVAPAEPIRAEQGWTVGELKQYIGEIFN
LDPSCMRLVLEVYNDGRHLPNDASSLKGEGLYRKHTLFAASDSEDYERQYKESVMYRHVE
AHVNSILLNITIPPLQESPPALQPEAPPNRPSTPPPSNQAGGEDDNRAEDEVPELVSSRE
GAGKKRHFSDDGVNGDREDQTGEKKRERNDDGTTENNEGVDSGDAGNNVGETNNDVGGAT
NDVGGATNGMGGASKDDVGPEEIMNDQKSKDNKEKEEEEGKSKPSSSVEGRKGGGGGGVL
KIRVDRRTTLAQLKEKLVPLINVPPTGFKVYRVYNNQQEYEMERLTDSLMAIPSESRFVV
RLGRALQVGECRIKVFLLHINNTEFFNLMMESIVAKNTPVREFKKQIIEEAKVQGIDCVL
ELDKMRLRKKTWRSPGTVYLDHQLIDKDIHVYAGSEMYVEPLKEPEKMKLPTQMQVYVRR
WRPSEYSVDPTEEVILDTASPLDLKKKLSELSEVPVDAISVAKGVGSFPAEISCLDIENE
LEWNPAIQSISQTPFSLYDDGGVIYYKDNREKMKEITAEERAEIEKTENKRVNSVGVYGT
GSSSSSGHSSYSYYRKERALKIYTDDDTPRDKED
NT seq 4245 nt NT seq  +upstreamnt  +downstreamnt
atggccactgattcagttgatgttgttgtctctggagagggagaaggaggagctgctcct
gctccaccagttactgatgaggtttttgctgattctgaaccgtctctctctggcccacta
gatacaactgagaagagtgttgagctctcaacattctctactagttacagatcgaatgtt
tctacagcaactgaaggaggagtatcatttgtcgttacagatgaaactaatcccacgtgg
cagtcgtcgcgttttaattttgtccttccattgtccacctcaattgatagtcttcatatt
actgtagctgatcatgctagctatgttaacgattcatttttgttaatatggcgtcgtcag
agtgaggaaggtgaagaggagattccattggatcattgctcaactgctactctccttgag
atgggaatggccgaggaaccgaagaaaacatacttactgataagagtgaaggatgatatg
caaccaactagagttggaaatgaaaatataacttccgaagctgaaagagaggcctcaaca
ggtcaagtctctactcaaatcactggtgcctcctcctcgtccagcggttggtcctcatac
actaacccaatctacaatagcaacacttatggatcgggaggtaacacgtccaactactcc
tcgtcaagtggatacgggtcttacagctacagttataacgctaaatctgagactggtttt
gtggggctggtaaatcaggccatgacctgttatttaaacagtttgctccagacactctac
atgactccagagtttaggaatgctttgtaccagtggaggtttgagtcaaaggcagagtcg
gaggatcaagcagtcgttgaggcaaccaagtgcatcccttaccagctacagcgtctcttt
ttacaactccagacggcaaaaaagagggcagtggagactactgatgtgaccaagagcttt
ggatgggacagcagtgaagcttggcagcagcatgacgttcaggaattgtgtcgtgtcatg
tttgatgctttagagaaaaggtttaaaaaggatcagacacaacaggttgatctgattaat
gatttatatcaagggaaatgcaaagattatgtaaagtgtaaagaatgtggatatgaaagt
gctcgtgaagacatatttcttgatattcctcttgtcataaaacctttcggacgctctgag
acttatggaagtgttgaagaagcaatgaaggcatttgttgaaccagaaactcttgaagga
gacaaccagtatcactgtactaaatgcaataccaagcgagatgctcttaagggtcttaaa
ttcaagcagttcccatacctcctcactcttcaactcaaaagatttgattttgactacacc
acaatgcaccgtatcaaactgaatgacaggatgacattccccaaggttcttgatctgaat
gatttcattgatgaagatgatagaccttcagttcctaatgatgttcctgaaaagtataag
acttttgtggtagagcgttttgacagacctcatgaccagcctccatcttactcctccatc
acctcctccacccttccttcatattctcaagctactggtggttctaataaagctgatgaa
cctgatgaaactgatgtagctgagaaaggagatagaccaaagcctcctgatgttgccagc
atgttatctcatggtccttatgtctatgagttattctcaatcatgattcattcagggagt
gctattggtggacattactatgcatacattaagtctttcaaggataagaggtggtattgt
ttcaatgatcagagtgtgaccaggataactcaagaggagatagagcagacgtttggtggt
tcagaccgctcatcatcaagaggctactattcctcaatgtacagctactctgctaatgca
tacatgttgatgtacagaagaattgataccaatgaaaatgcagattttttgcaggatgac
cagttccctgatcacttgaagaaacagattgaggatgacaaggagagagaggccaatgag
aagaagaagcaagagatggagaaacagatgtgcaaatttaagttattttgtgttcatcct
gttactggcaaaatgattgagtcaagatttgaaatacaccaggatactaaactaccccaa
gcactggctgaagcttataagacaatgaaactagctcctcatattcctattgagagatgt
cgtttggttaaatatgatgattattctgaaacaatggatcaatcctttgatcttgatgag
tttcaagatcaaacttttggacagcttgtgggtggcgctagaaattattattcatttgaa
atgtttctagagactcgtaaagaaaacgaagcctttaagaaatacaataagggaggcatg
aaattaaagatagctgtgattgatctgtcaactggtgatgtggcaccagctgaaccaata
agagcagaacaaggttggactgttggagaattaaagcaatatataggagaaatattcaat
cttgatccttcatgtatgaggctggtccttgaggtgtataatgatggtagacatttacca
aatgatgctagttcactaaaaggagaaggactctacaggaaacacacactatttgctgcc
tctgattctgaagattatgagagacaatacaaagagagtgtcatgtacagacacgttgaa
gctcacgtcaactcaatactactaaacattacaatacctcctctacaagaatccccacca
gcccttcagcctgaagcccctcccaatcgaccttcgactccgccccctagcaaccaagct
ggaggagaagatgataatagagcagaagatgaagtccccgaattagtgtctagtagagaa
ggagctggtaagaagaggcacttcagtgatgatggagttaatggggacagggaggatcag
acaggagagaaaaagagagaacggaatgacgatggaacaaccgaaaataacgaaggagtg
gatagcggagatgctggcaataatgtgggcgagactaataatgatgtgggtggggctact
aatgatgtgggcggggctactaatggcatgggcggggcatccaaagatgacgtaggtcct
gaggagataatgaatgatcagaaatcaaaagataacaaagagaaagaggaggaggagggg
aagagtaaaccttcaagcagtgtggaaggaaggaaaggaggaggaggaggaggggtttta
aagataagagttgataggagaaccacattagctcaattgaaggagaagctagttccactg
attaacgtaccacctactggttttaaagtgtatagggtgtataataaccagcaagaatat
gaaatggaaagattaactgactcattaatggcaataccttcagaatcaagatttgtagta
agactgggtagggcattacaagtaggagagtgcaggattaaagtatttttattacacatt
aacaatacagagttctttaatctgatgatggagtctattgttgctaagaatacaccagtg
agagaatttaagaaacaaattattgaagaagcaaaagtacaaggaattgactgtgtcctt
gaattagacaaaatgagattacgcaaaaagacttggaggtcacctggtacagtgtatctt
gatcatcagttgattgataaagatattcatgtatatgctggtagtgaaatgtatgtggaa
ccattgaaagaacctgaaaagatgaagctcccaacacagatgcaggtgtatgttagaaga
tggcgtccatcagaatattcagttgatccaacagaagaagttatactggacacagctagt
cccttagatcttaaaaagaagctttcagagttaagtgaagttcctgttgatgccatttct
gttgcaaagggtgtgggatcatttccagctgagatatcatgtcttgatattgagaatgag
ttggaatggaatccagccattcaatcaatcagtcaaacaccattttcattgtatgatgat
ggaggtgtcatttattacaaagacaatagagaaaaaatgaaagagatcacagctgaagag
agagcagaaatagaaaagacagaaaacaaaagggtcaatagtgttggtgtatatggtact
ggctcatcatcatcaagtggtcattcaagctacagctactataggaaagagagagcactt
aagatttatactgatgatgacactccaagagacaaagaggactga

DBGET integrated database retrieval system