KEGG   Amphimedon queenslandica (sponge): 100639726Help
Entry
100639726         CDS       T02284                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 47
  KO
K11857  
ubiquitin carboxyl-terminal hydrolase 47 [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100639726
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100639726
Ubiquitin system [BR:aqu04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100639726
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 1487 aa AA seqDB search
MATDSVDVVVSGEGEGGAAPAPPVTDEVFADSEPSLSGPLDTTEKSVELSTFSTSYRSNV
STATEGGVSFVVTDETNPTWQSSRFNFVLPLSTSIDSLHITVADHASYVNDSFLLIWRRQ
SEEGEEEIPLDHCSTATLLEMGMAEEPKKTYLLIRVKDDMQPTRVGNENITSEAEREAST
GQVSTQITGASSSSSGWSSYTNPIYNSNTYGSGGNTSNYSSSSGYGSYSYSYNAKSETGF
VGLVNQAMTCYLNSLLQTLYMTPEFRNALYQWRFESKAESEDQAVVEATKCIPYQLQRLF
LQLQTAKKRAVETTDVTKSFGWDSSEAWQQHDVQELCRVMFDALEKRFKKDQTQQDKPTD
KPAANEGEKEGEGEGGKEGEEEQGGEGSENIDGSSSSQAEGETPKARDVRVDLINDLYQG
KCKDYVKCKECGYESAREDIFLDIPLVIKPFGRSETYGSVEEAMKAFVEPETLEGDNQYH
CTKCNTKRDALKGLKFKQFPYLLTLQLKRFDFDYTTMHRIKLNDRMTFPKVLDLNDFIDE
DDRPSVPNDVPEKYKTFVVERFDRPHDQPPSYSSITSSTLPSYSQATGGSNKADEPDETD
VAEKGDRPKPPDVASMLSHGPYVYELFSIMIHSGSAIGGHYYAYIKSFKDKRWYCFNDQS
VTRITQEEIEQTFGGSDRSSSRGYYSSMYSYSANAYMLMYRRIDTNENADFLQDDQFPDH
LKKQIEDDKEREANEKKKQEMEKQMCKFKLFCVHPVTGKMIESRFEIHQDTKLPQALAEA
YKTMKLAPHIPIERCRLVKYDDYSETMDQSFDLDEFQDQTFGQLVGGARNYYSFEMFLET
RKENEAFKKYNKGGMKLKIAVIDLSTGDVAPAEPIRAEQGWTVGELKQYIGEIFNLDPSC
MRLVLEVYNDGRHLPNDASSLKGEGLYRKHTLFAASDSEDYERQYKESVMYRHVEAHVNS
ILLNITIPPLQESPPALQPEAPPNRPSTPPPSNQAGGEDDNRAEDEVPELVSSREGAGKK
RHFSDDGVNGDREDQTGEKKRERNDDGTTENNEGVDSGDAGNNVGETNNDVGGATNDVGG
ATNGMGGASKDDVGPEEIMNDQKSKDNKEKEEEEGKSKPSSSVEGRKGGGGGGVLKVVSL
SKNEEEKGKKRDIQIRVDRRTTLAQLKEKLVPLINVPPTGFKVYRVYNNQQEYEMERLTD
SLMAIPSESRFVVRLGRALQVGECRIKVFLLHINNTEFFNLMMESIVAKNTPVREFKKQI
IEEAKVQGIDCVLELDKMRLRKKTWRSPGTVYLDHQLIDKDIHVYAGSEMYVEPLKEPEK
MKLPTQMQVYVRRWRPSEYSVDPTEEVILDTASPLDLKKKLSELSEVPVDAISVAKGVGS
FPAEISCLDIENELEWNPAIQSISQTPFSLYDDGGVIYYKDNREKMKEITAEERAEIEKT
ENKRVNSVGVYGTGSSSSSGHSSYSYYRKERALKIYTDDDTPRDKED
NT seq 4464 nt NT seq  +upstreamnt  +downstreamnt
atggccactgattcagttgatgttgttgtctctggagagggagaaggaggagctgctcct
gctccaccagttactgatgaggtttttgctgattctgaaccgtctctctctggcccacta
gatacaactgagaagagtgttgagctctcaacattctctactagttacagatcgaatgtt
tctacagcaactgaaggaggagtatcatttgtcgttacagatgaaactaatcccacgtgg
cagtcgtcgcgttttaattttgtccttccattgtccacctcaattgatagtcttcatatt
actgtagctgatcatgctagctatgttaacgattcatttttgttaatatggcgtcgtcag
agtgaggaaggtgaagaggagattccattggatcattgctcaactgctactctccttgag
atgggaatggccgaggaaccgaagaaaacatacttactgataagagtgaaggatgatatg
caaccaactagagttggaaatgaaaatataacttccgaagctgaaagagaggcctcaaca
ggtcaagtctctactcaaatcactggtgcctcctcctcgtccagcggttggtcctcatac
actaacccaatctacaatagcaacacttatggatcgggaggtaacacgtccaactactcc
tcgtcaagtggatacgggtcttacagctacagttataacgctaaatctgagactggtttt
gtggggctggtaaatcaggccatgacctgttatttaaacagtttgctccagacactctac
atgactccagagtttaggaatgctttgtaccagtggaggtttgagtcaaaggcagagtcg
gaggatcaagcagtcgttgaggcaaccaagtgcatcccttaccagctacagcgtctcttt
ttacaactccagacggcaaaaaagagggcagtggagactactgatgtgaccaagagcttt
ggatgggacagcagtgaagcttggcagcagcatgacgttcaggaattgtgtcgtgtcatg
tttgatgctttagagaaaaggtttaaaaaggatcagacacaacaagacaagccaacggat
aaaccagcagctaatgaaggagagaaggagggagagggagaaggagggaaagaaggagag
gaagaacaaggaggagagggtagtgaaaatattgatggctctagttcatctcaagctgag
ggtgagacaccaaaagcaagagatgtgagggttgatctgattaatgatttatatcaaggg
aaatgcaaagattatgtaaagtgtaaagaatgtggatatgaaagtgctcgtgaagacata
tttcttgatattcctcttgtcataaaacctttcggacgctctgagacttatggaagtgtt
gaagaagcaatgaaggcatttgttgaaccagaaactcttgaaggagacaaccagtatcac
tgtactaaatgcaataccaagcgagatgctcttaagggtcttaaattcaagcagttccca
tacctcctcactcttcaactcaaaagatttgattttgactacaccacaatgcaccgtatc
aaactgaatgacaggatgacattccccaaggttcttgatctgaatgatttcattgatgaa
gatgatagaccttcagttcctaatgatgttcctgaaaagtataagacttttgtggtagag
cgttttgacagacctcatgaccagcctccatcttactcctccatcacctcctccaccctt
ccttcatattctcaagctactggtggttctaataaagctgatgaacctgatgaaactgat
gtagctgagaaaggagatagaccaaagcctcctgatgttgccagcatgttatctcatggt
ccttatgtctatgagttattctcaatcatgattcattcagggagtgctattggtggacat
tactatgcatacattaagtctttcaaggataagaggtggtattgtttcaatgatcagagt
gtgaccaggataactcaagaggagatagagcagacgtttggtggttcagaccgctcatca
tcaagaggctactattcctcaatgtacagctactctgctaatgcatacatgttgatgtac
agaagaattgataccaatgaaaatgcagattttttgcaggatgaccagttccctgatcac
ttgaagaaacagattgaggatgacaaggagagagaggccaatgagaagaagaagcaagag
atggagaaacagatgtgcaaatttaagttattttgtgttcatcctgttactggcaaaatg
attgagtcaagatttgaaatacaccaggatactaaactaccccaagcactggctgaagct
tataagacaatgaaactagctcctcatattcctattgagagatgtcgtttggttaaatat
gatgattattctgaaacaatggatcaatcctttgatcttgatgagtttcaagatcaaact
tttggacagcttgtgggtggcgctagaaattattattcatttgaaatgtttctagagact
cgtaaagaaaacgaagcctttaagaaatacaataagggaggcatgaaattaaagatagct
gtgattgatctgtcaactggtgatgtggcaccagctgaaccaataagagcagaacaaggt
tggactgttggagaattaaagcaatatataggagaaatattcaatcttgatccttcatgt
atgaggctggtccttgaggtgtataatgatggtagacatttaccaaatgatgctagttca
ctaaaaggagaaggactctacaggaaacacacactatttgctgcctctgattctgaagat
tatgagagacaatacaaagagagtgtcatgtacagacacgttgaagctcacgtcaactca
atactactaaacattacaatacctcctctacaagaatccccaccagcccttcagcctgaa
gcccctcccaatcgaccttcgactccgccccctagcaaccaagctggaggagaagatgat
aatagagcagaagatgaagtccccgaattagtgtctagtagagaaggagctggtaagaag
aggcacttcagtgatgatggagttaatggggacagggaggatcagacaggagagaaaaag
agagaacggaatgacgatggaacaaccgaaaataacgaaggagtggatagcggagatgct
ggcaataatgtgggcgagactaataatgatgtgggtggggctactaatgatgtgggcggg
gctactaatggcatgggcggggcatccaaagatgacgtaggtcctgaggagataatgaat
gatcagaaatcaaaagataacaaagagaaagaggaggaggaggggaagagtaaaccttca
agcagtgtggaaggaaggaaaggaggaggaggaggaggggttttaaaggtagtgtcctta
tcaaagaatgaagaagagaaaggaaagaaaagagatatacagataagagttgataggaga
accacattagctcaattgaaggagaagctagttccactgattaacgtaccacctactggt
tttaaagtgtatagggtgtataataaccagcaagaatatgaaatggaaagattaactgac
tcattaatggcaataccttcagaatcaagatttgtagtaagactgggtagggcattacaa
gtaggagagtgcaggattaaagtatttttattacacattaacaatacagagttctttaat
ctgatgatggagtctattgttgctaagaatacaccagtgagagaatttaagaaacaaatt
attgaagaagcaaaagtacaaggaattgactgtgtccttgaattagacaaaatgagatta
cgcaaaaagacttggaggtcacctggtacagtgtatcttgatcatcagttgattgataaa
gatattcatgtatatgctggtagtgaaatgtatgtggaaccattgaaagaacctgaaaag
atgaagctcccaacacagatgcaggtgtatgttagaagatggcgtccatcagaatattca
gttgatccaacagaagaagttatactggacacagctagtcccttagatcttaaaaagaag
ctttcagagttaagtgaagttcctgttgatgccatttctgttgcaaagggtgtgggatca
tttccagctgagatatcatgtcttgatattgagaatgagttggaatggaatccagccatt
caatcaatcagtcaaacaccattttcattgtatgatgatggaggtgtcatttattacaaa
gacaatagagaaaaaatgaaagagatcacagctgaagagagagcagaaatagaaaagaca
gaaaacaaaagggtcaatagtgttggtgtatatggtactggctcatcatcatcaagtggt
cattcaagctacagctactataggaaagagagagcacttaagatttatactgatgatgac
actccaagagacaaagaggactga

DBGET integrated database retrieval system