KEGG   Amphimedon queenslandica (sponge): 100639856Help
Entry
100639856         CDS       T02284                                 

Definition
(RefSeq) calcineurin B homologous protein 1-like
  KO
K17610  calcineurin B homologous protein 1
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100639856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 100639856
NCBI-ProteinID: XP_003385569
UniProt: A0A1X7V6Z0
Position
Unknown
AA seq 194 aa AA seqDB search
MGNSSSINLTEEDYEQIRAETGFDNSQIRRLYSRFSHLDKRSKGYLTRQDLMLIPDLAIN
PLGTRIIDVFFLDEENSSRVVEEVNFRQFIRTLALFHNKNKGDGTTSCDEKRIEFLFKIY
DKDRDGKLSKDDLAHVLSCLVGHHIAQEQVYSIVKRTMREADINEDQFISLEEFKQALKD
IDIQNKMTFNFSRT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactcgagttctatcaatttaactgaagaagattacgagcaaataagagccgag
actggcttcgataatagtcaaatccgtcgcctctactcaagattttctcacctagacaag
agaagcaagggctacctaactcgccaagacttgatgctgatacccgatctggccatcaat
cctttaggaacaagaatcattgatgtattcttccttgacgaagagaattccagtcgagtt
gttgaagaggttaatttccgtcagttcatacgcacgcttgctctctttcataataaaaac
aaaggggatggtactaccagctgtgatgaaaagaggattgaattcttattcaagatatat
gacaaggacagagatgggaagctatcaaaagatgacctagcacatgtcctgtcttgtctg
gttggtcatcatatagcacaggagcaggtctactccattgtcaagagaacaatgagagaa
gctgatatcaatgaagatcaatttatatctcttgaagaatttaaacaagctttgaaagat
atcgatattcagaacaagatgacattcaacttttcaagaacataa

DBGET integrated database retrieval system