KEGG   Amphimedon queenslandica (sponge): 100639856Help
Entry
100639856         CDS       T02284                                 

Definition
calcium-binding protein p22-like
Orthology
K17610  
calcineurin B homologous protein 1
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100639856
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 194 aa AA seqDB search
MGNSSSINLTEEDYEQIRAETGFDNSQIRRLYSRFSHLDKRSKGYLTRQDLMLIPDLAIN
PLGTRIIDVFFLDEENSSRVVEEVNFRQFIRTLALFHNKNKGDGTTSCDEKRIEFLFKIY
DKDRDGKLSKDDLAHVLSCLVGHHIAQEQVYSIVKRTMREADINEDQFISLEEFKQALKD
IDIQNKMTFNFSRT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgggtaactcgagttctatcaatttaactgaagaagattacgagcaaataagagccgag
actggcttcgataatagtcaaatccgtcgcctctactcaagattttctcacctagacaag
agaagcaagggctacctaactcgccaagacttgatgctgatacccgatctggccatcaat
cctttaggaacaagaatcattgatgtattcttccttgacgaagagaattccagtcgagtt
gttgaagaggttaatttccgtcagttcatacgcacgcttgctctctttcataataaaaac
aaaggggatggtactaccagctgtgatgaaaagaggattgaattcttattcaagatatat
gacaaggacagagatgggaagctatcaaaagatgacctagcacatgtcctgtcttgtctg
gttggtcatcatatagcacaggagcaggtctactccattgtcaagagaacaatgagagaa
gctgatatcaatgaagatcaatttatatctcttgaagaatttaaacaagctttgaaagat
atcgatattcagaacaagatgacattcaacttttcaagaacataa

  All links  
No link information was found.   
DBGET integrated database retrieval system