KEGG   Amphimedon queenslandica (sponge): 100640032Help
Entry
100640032         CDS       T02284                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 46-like
  KO
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100640032
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100640032
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 349 aa AA seqDB search
MGANGSTLERLEQLPEDERYNGLTNFGNTCYANSVLQALYFCLPFREKVLQYSHGEEKTE
TLLSALSDLFIQMSSSKKKFGVVAPRKFIQRVKKENVVFDNMQQQDAHEFLNYLLNTIAD
LLKAQMPESSEDTNTWIHDIFQGVLVNETKCLSCETVRSKQEDFLDLSVDIEQNSSITHC
LKMFSGSETLSSEYKYYCEQCCSKQEATKRLRIKKLPTILALHLKRFKFMEQLHRHTKLS
HRVVFPWELKLFNTSDDASDPDRMYDLIGVVIHCGTGPNRGHYISVIKSHGYWLXXXXXX
LQEIEPHSIEQFFGLTDSQTSLPNESAYILFYKTRESEYTYEMVNEDQT
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgggtgccaatggctcgactctagagagactagagcaactgccagaagatgagagatac
aatggcctaactaattttggtaatacctgctatgccaattcagtcctacaggctctttat
ttctgtctcccgttccgagagaaggtattgcagtattctcacggagaagagaagaccgag
acgcttctttctgctctctctgatctcttcattcaaatgagtagttctaagaagaagttt
ggggtcgtggccccgcgtaaatttattcaaagagtaaagaaagagaatgttgtgtttgat
aatatgcagcaacaagatgcccatgagttcttgaattacctactaaatacaatagcagat
ttattaaaagctcaaatgcctgaatcatcagaagacacgaacacttggatccatgatata
ttccaaggtgtactagttaatgagacaaagtgcctctcctgtgagacagtaagaagcaaa
caagaagatttcttagatctctcagttgatattgaacagaattcatccatcactcactgc
ctgaagatgttcagtggtagtgaaaccctatcctcagaatataagtattactgtgagcag
tgctgcagtaagcaagaagcaaccaagaggcttagaataaagaagctcccgacgatactt
gcgctccatctcaagaggttcaagtttatggagcaactccacagacacacaaagctctct
caccgagtggtgtttccatgggaactgaagctattcaatacatcggatgatgctagtgat
cctgacagaatgtatgacctaatcggtgtggtgatacactgtggaactggtcctaacaga
ggtcattatatatcagttattaagagtcatggctactggctannnnnnnnnnnnnnnnta
ttgcaggagatagagcctcactccattgagcagttctttggactgacggactctcaaacg
agtctaccgaacgagtcggcttatattttattttataaaacgagagaaagcgaatacacg
tatgaaatggtcaatgaagatcagacatga

DBGET integrated database retrieval system