KEGG   Amphimedon queenslandica (sponge): 100640047Help
Entry
100640047         CDS       T02284                                 

Definition
profilin-4-like
Orthology
K05759  
profilin
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 133 aa AA seqDB search
MSSTHQQLLQEVLTATGNVETCCLIRKASGSVKAASIGFEPSKDLVQSLVDGFNELKKVR
EEGIDFNGASYQCVRADNTSIYGKKGGGSGFIAVQTKQYIIYGSFSTSMYPSITAEAIHS
LGKHIIIRPQDNN
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctacccatcaacagttactgcaggaggttctgacggccactgggaatgtagag
acatgttgtctgatcaggaaagcatcaggatcagtaaaggcagcctcgattggatttgaa
cctagtaaagacctagttcagtccttagttgatgggtttaatgagcttaagaaagtacgc
gaagaaggtattgattttaatggagcgtcatatcaatgtgtgagagcagataacacttcc
atttacgggaaaaagggtggtggatcaggctttattgcagtgcagactaagcagtacatc
atttacgggagtttttctacgtcaatgtatcccagcataactgctgaagctattcacagt
ttaggtaaacacataatcatacgcccccaggataacaattaa

DBGET integrated database retrieval system