KEGG   Amphimedon queenslandica (sponge): 100640083Help
Entry
100640083         CDS       T02284                                 

Definition
beta-hexosaminidase subunit beta-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aqu00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:aqu00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:aqu00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:aqu00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:aqu00511]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aqu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 521 aa AA seqDB search
MVRSVLLLFLFVAVSFRLVFGDASITSDLLWPHPSQSTFGTDVYEVDSGNFAFTTDGAGG
ASILLKSAIDRYYVTIFQTAAPFFPSGGATQPKGPLTGLKVTVNNADESLNLTTDESYTL
TVAADGAAITATTVFGAMRGLETFSQLIYHMPNGGLAINQVTSITDKPRFQYRGIMIDTS
RHFLNLHTILTHLDAMVYSKFNILHWHIVDDQSFPYESYTFPDLAAKGAYDHEHIYTQED
VKTVINYAYERGIRVIPEFDTPGHTQSWGAGQANLLTPCSGGGFGPIDPILNTTWTFLSS
FYEEISKVFPDDYIHLGGDEVSFGCWQGNADIQAWMKKMGYTDYAKLEEYYENNLIDLIN
KLNKSYVVWQEIFDNGLKIKMDTVIDVWKGGWQKEMDAVTKAGYNVILSTCWYLNYISYG
EDWKNYYGCDPQAFNGTDEQNSKVVGGHACMWAELVDSSNFMPRMWPRACAVGERLWSPK
TVTDVNDARTRLLNHRCRLLTRGIRAEPLGPSYCNDEWHGP
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggtctgttctgcttctttttctcttcgttgctgtgtcttttcgtctcgtgttt
ggagacgccagcattacttcggaccttctctggccccatccttctcagtctacatttggt
accgatgtctatgaggtagactcgggaaattttgcctttacaaccgatggagctggaggt
gctagcattctcctcaaatcagccatagacaggtactatgtgactatattccagactgct
gctcctttctttccttctggtggagccactcaaccaaagggacctctgacaggacttaaa
gtgactgttaacaacgcggatgagtcactgaatctaaccacagatgaatcttatactttg
actgttgctgctgatggtgcagccataacagctactactgtatttggagcaatgagagga
cttgaaacttttagccagcttatttatcacatgccaaatggaggacttgctataaatcaa
gtgacaagtatcactgacaaaccaaggtttcaatatcgtgggattatgattgacacctcc
agacacttccttaatctccacacaatactaactcatcttgatgcaatggtatacagcaag
tttaatatactccattggcatattgtggatgatcagtcctttccttatgaatcatacacc
tttcctgacctagctgctaagggagcatatgatcatgagcacatttatacacaagaagat
gtgaagactgttattaattatgcttatgaacgaggcataagagttatacctgaattcgat
actccaggtcatactcagtcgtggggtgctggacaggcaaacctattgactccttgcagt
ggaggtgggtttggtccgattgatccaattctaaatactacatggacattcttgagttca
ttctatgaggaaattagtaaagttttccctgacgattacattcatttgggaggagacgag
gtctcttttggttgctggcagggtaatgctgatatacaagcatggatgaagaaaatggga
tacactgattatgctaaacttgaggaatattatgaaaacaatttgattgatttgatcaat
aaactgaataagagttatgttgtgtggcaagaaatatttgacaacggactgaagatcaaa
atggatacagttattgatgtatggaaaggaggatggcaaaaagaaatggatgctgtaact
aaagctggttacaacgttatcctatcaacctgttggtatctgaactacatcagctatgga
gaagactggaaaaattattatggttgtgatcctcaagctttcaatggtactgatgaacag
aattctaaagttgttggtggtcatgcctgcatgtgggcagaacttgttgattcgtcaaat
tttatgccaagaatgtggccaagagcatgtgcagtgggtgagaggttatggagtccaaag
acagtcactgatgtcaatgatgcaaggactagactattgaatcatcgctgcagactactg
actcgtggtattcgtgctgagccacttggtcccagttattgcaatgatgagtggcatgga
ccttga

DBGET integrated database retrieval system