KEGG   Amphimedon queenslandica (sponge): 100640192Help
Entry
100640192         CDS       T02284                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100640192
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100640192
   04070 Phosphatidylinositol signaling system
    100640192
   04150 mTOR signaling pathway
    100640192
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100640192
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100640192
Membrane trafficking [BR:aqu04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100640192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1014 aa AA seqDB search
MDILMPTGMLITLACYKQASLSDIKAAVWQEARNQPLFEMIKDQSFYSFFGITADGNKEE
LVNESHSLADIDLFVPLLKLKERAGDMKEKKLNAEIGALIGRKLADFDVMEAEVQDCRRH
WLFVCEEVLNLRQMNDETLRRYNFSALTVGPDEPNLSQQALNGELEVSFLNARGQMYPLK
LPFSYDRSASDLINLSFSQPEVRKSFKRYQPKDFSLKVQGSEEYLLENVPLQQYKPKFCL
IPYEGILTVEKDVFIRPIHALQSGKDAKWQSDCGPFNLSRGTIGKDQMSYISTWNVRQTY
KIKVVGAANINVSDTMKVYVRAGLGHGDQTLCPTTSTSKGASPEKPEWNELLEFDVPILE
MPRSAKLCFIIYQQKQPGRKSKEDAPLAWVNLNAFDYDGVLQAGRFTLNAWPIEDDHAIQ
DQLNYIGSTVPNAHLSKSIQLTIEIPHFSSVPILFPSASEIQAFAVEMAQGSVSSARFNN
QEIDELRRIIEQDPLDELDESDKEILWKMRNVCCDRHPEALPKLLQSVTWSNRSDVAQVY
LLLERWSRLNPEQAMELLHFQYADLAVRQYAVTCLESLSDNKLLMYLLQLVQALKFEPYL
DCPLAEFLLKKALSNKSIGHYLFWYLRAEMHLPIVSVRYGLILEAYCRGCGRYRESLAKQ
VDALGKWKQVTGELQKVQKAKKSKAVDERDFLRTPHLLKAMEDLRSPLNPALMLKNLLPD
KCKVMDSKMRPLWLSFVNMDPLGGTVLQIFKNGDDLRQDMLTLQVMNIMDNVWREAGLDL
RMNPYACLSMGDQVGLIEVVLDSTTIAKIQKQQSGARGAFDKKLLYSWLKSKNKSQAELN
KAVDNFTLSCAGSCVATYVLGIGDRHSDNIMLKSNGQLVHIDFGHFLGNFKSKFGVKRER
VPFVLTDDFIHIITREEGKTSFEFVKFKNLCEKAFMLLRQKGDLFITLFTMMLSTGIPEL
RTIDDIRYISNALCLSKNDDQAKEDFRKKLAEAVKHSWSVSINWYFHNVARTGN
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggacatattgatgcctactggcatgcttataaccctcgcctgctacaaacaagcatct
ctatcggatataaaggctgccgtgtggcaagaggcccgtaaccagccgttatttgaaatg
atcaaggaccagagcttctactccttctttggtatcactgctgatggtaacaaggaagaa
ctggttaatgagtcacacagtttggctgacattgatctgtttgttccgcttctgaagctg
aaagagagagcaggagacatgaaagagaagaaactcaatgccgagatcggggctctcatc
ggtcgtaaactggcagatttcgacgtgatggaagccgaggtccaagactgtcggcgtcac
tggctgttcgtgtgtgaggaggttcttaatttgcgtcaaatgaatgatgagactttgaga
aggtataacttctctgctcttactgtaggaccagatgagccaaacctcagccagcaagca
ctgaatggtgagcttgaagtcagtttccttaatgcccgtggtcagatgtacccgctgaag
ttacccttttcctacgacaggtctgcctctgacctcattaatctctccttctctcagcct
gaggttcggaaatccttcaagcgctaccaaccgaaggactttagtcttaaagtccaagga
tccgaagaatatctattggaaaatgtaccactacaacaatacaagccaaaattctgccta
atcccgtatgaaggaatactaacagttgaaaaggacgtatttattcgtcctattcatgca
cttcaatctggaaaggatgcaaagtggcagtcggactgtggcccttttaatttgtctcgt
gggacaatcgggaaagatcaaatgtcttatatatcaacttggaacgtgaggcagacctat
aaaattaaagttgttggagctgctaatatcaacgtatctgatactatgaaagtttatgtg
agggctggtcttggtcacggcgatcaaactctatgtcctaccacttcaacttcaaaggga
gcatcccccgagaaaccagagtggaacgagctccttgagtttgatgtgcctatacttgaa
atgcctcggagcgccaaactctgtttcataatatatcagcagaaacagccaggacgaaag
agcaaagaagatgctcccttggcttgggtgaacttgaatgcgtttgattatgatggtgtc
cttcaggctggccgctttactctcaatgcgtggcccatcgaagatgatcatgccattcaa
gatcagttaaactatattgggtctacagtacctaatgcccacctttccaaatccattcag
ttgacaattgagatacctcacttcagctcagttcctatattgttcccttcggctagtgag
atacaagcctttgctgttgaaatggcccaaggctcagtttcttcagctcgttttaataac
caggagatcgatgagcttcgtcgaatcatagaacaagatcctcttgacgaattggatgaa
tctgacaaagaaattctatggaaaatgaggaacgtgtgctgtgacagacaccctgaagct
ctgcctaagttattgcagtcagtcacctggagcaatcggagtgatgtagcacaggtatat
ttgttgctggagaggtggtctcgtctcaacccagagcaggctatggagctccttcatttc
cagtatgctgatttagcagtgagacagtatgctgtaacctgcttggaatcattgagtgat
aataagctactcatgtatttgctccagctggttcaagctcttaaatttgagccgtatctt
gactgccccctggcagagtttctcctgaagaaagctcttagcaataaatcaattggacac
tatcttttctggtatctcagagctgaaatgcatctacctattgtgtcagtacgttatggt
ctcattcttgaggcttattgtagggggtgtggccgctacagagagtcattagccaagcag
gttgatgctcttggtaagtggaagcaggtgactggtgagctccagaaggtgcagaaagcg
aaaaagtctaaggctgtggacgagagagatttcttgaggactcctcatcttctgaaggca
atggaagaccttcggtctccgctaaatccagccttgatgcttaaaaacctccttccagat
aaatgtaaagtgatggacagcaagatgaggcccctttggctatcattcgtcaacatggat
ccactcggcggtactgtactacagatattcaagaacggagatgatctaaggcaagacatg
ctgaccctacaagttatgaacattatggacaacgtctggcgtgaggccggcctagattta
agaatgaatccttatgcttgtttgtcgatgggtgaccaggttggtctgattgaggtggtg
ttggactccacaactatagctaagatacagaagcagcagagtggagcaagaggagccttt
gataaaaagttgctgtactcctggttgaagagtaagaataaatctcaagcagaattaaat
aaagcagttgataacttcacattgtcatgtgctggtagctgcgtagccacttatgtactt
ggtataggggataggcactcagacaatataatgctcaaatctaatggacaattggttcat
attgattttggtcacttccttggtaactttaagagcaagtttggcgtgaaacgtgagaga
gtgccctttgtccttactgacgattttattcacatcattaccagagaagaagggaagaca
tcatttgagtttgtcaagtttaagaacctttgcgagaaggcttttatgctcttacgtcag
aaaggagatctcttcatcacactcttcactatgatgctctccactggtattcctgaactt
aggacgatcgatgacattcgctacatcagcaatgctctttgtctttctaaaaatgatgac
caggcaaaggaggatttccgtaagaagttggcagaggctgtcaagcattcttggagtgtc
agtattaactggtatttccataatgtggcacgtactgggaattaa

DBGET integrated database retrieval system