KEGG   Amphimedon queenslandica (sponge): 100640192Help
Entry
100640192         CDS       T02284                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100640192
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100640192
   04068 FoxO signaling pathway
    100640192
   04070 Phosphatidylinositol signaling system
    100640192
   04150 mTOR signaling pathway
    100640192
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100640192
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1014 aa AA seqDB search
MDILMPTGMLITLACYKQASLSDIKAAVWQEARNQPLFEMIKDQSFYSFFGITADGNKEE
LVNESHSLADIDLFVPLLKLKERAGDMKEKKLNAEIGALIGRKLADFDVMEAEVQDCRRH
WLFVCEEVLNLRQMNDETLRRYNFSALTVGPDEPNLSQQALNGELEVSFLNARGQMYPLK
LPFSYDRSASDLINLSFSQPEVRKSFKRYQPKDFSLKVQGSEEYLLENVPLQQYKPKFCL
IPYEGILTVEKDVFIRPIHALQSGKDAKWQSDCGPFNLSRGTIGKDQMSYISTWNVRQTY
KIKVVGAANINVSDTMKVYVRAGLGHGDQTLCPTTSTSKGASPEKPEWNELLEFDVPILE
MPRSAKLCFIIYQQKQPGRKSKEDAPLAWVNLNAFDYDGVLQAGRFTLNAWPIEDDHAIQ
DQLNYIGSTVPNAHLSKSIQLTIEIPHFSSVPILFPSASEIQAFAVEMAQGSVSSARFNN
QEIDELRRIIEQDPLDELDESDKEILWKMRNVCCDRHPEALPKLLQSVTWSNRSDVAQVY
LLLERWSRLNPEQAMELLHFQYADLAVRQYAVTCLESLSDNKLLMYLLQLVQALKFEPYL
DCPLAEFLLKKALSNKSIGHYLFWYLRAEMHLPIVSVRYGLILEAYCRGCGRYRESLAKQ
VDALGKWKQVTGELQKVQKAKKSKAVDERDFLRTPHLLKAMEDLRSPLNPALMLKNLLPD
KCKVMDSKMRPLWLSFVNMDPLGGTVLQIFKNGDDLRQDMLTLQVMNIMDNVWREAGLDL
RMNPYACLSMGDQVGLIEVVLDSTTIAKIQKQQSGARGAFDKKLLYSWLKSKNKSQAELN
KAVDNFTLSCAGSCVATYVLGIGDRHSDNIMLKSNGQLVHIDFGHFLGNFKSKFGVKRER
VPFVLTDDFIHIITREEGKTSFEFVKFKNLCEKAFMLLRQKGDLFITLFTMMLSTGIPEL
RTIDDIRYISNALCLSKNDDQAKEDFRKKLAEAVKHSWSVSINWYFHNVARTGN
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggacatattgatgcctactggcatgcttataaccctcgcctgctacaaacaagcatct
ctatcggatataaaggctgccgtgtggcaagaggcccgtaaccagccgttatttgaaatg
atcaaggaccagagcttctactccttctttggtatcactgctgatggtaacaaggaagaa
ctggttaatgagtcacacagtttggctgacattgatctgtttgttccgcttctgaagctg
aaagagagagcaggagacatgaaagagaagaaactcaatgccgagatcggggctctcatc
ggtcgtaaactggcagatttcgacgtgatggaagccgaggtccaagactgtcggcgtcac
tggctgttcgtgtgtgaggaggttcttaatttgcgtcaaatgaatgatgagactttgaga
aggtataacttctctgctcttactgtaggaccagatgagccaaacctcagccagcaagca
ctgaatggtgagcttgaagtcagtttccttaatgcccgtggtcagatgtacccgctgaag
ttacccttttcctacgacaggtctgcctctgacctcattaatctctccttctctcagcct
gaggttcggaaatccttcaagcgctaccaaccgaaggactttagtcttaaagtccaagga
tccgaagaatatctattggaaaatgtaccactacaacaatacaagccaaaattctgccta
atcccgtatgaaggaatactaacagttgaaaaggacgtatttattcgtcctattcatgca
cttcaatctggaaaggatgcaaagtggcagtcggactgtggcccttttaatttgtctcgt
gggacaatcgggaaagatcaaatgtcttatatatcaacttggaacgtgaggcagacctat
aaaattaaagttgttggagctgctaatatcaacgtatctgatactatgaaagtttatgtg
agggctggtcttggtcacggcgatcaaactctatgtcctaccacttcaacttcaaaggga
gcatcccccgagaaaccagagtggaacgagctccttgagtttgatgtgcctatacttgaa
atgcctcggagcgccaaactctgtttcataatatatcagcagaaacagccaggacgaaag
agcaaagaagatgctcccttggcttgggtgaacttgaatgcgtttgattatgatggtgtc
cttcaggctggccgctttactctcaatgcgtggcccatcgaagatgatcatgccattcaa
gatcagttaaactatattgggtctacagtacctaatgcccacctttccaaatccattcag
ttgacaattgagatacctcacttcagctcagttcctatattgttcccttcggctagtgag
atacaagcctttgctgttgaaatggcccaaggctcagtttcttcagctcgttttaataac
caggagatcgatgagcttcgtcgaatcatagaacaagatcctcttgacgaattggatgaa
tctgacaaagaaattctatggaaaatgaggaacgtgtgctgtgacagacaccctgaagct
ctgcctaagttattgcagtcagtcacctggagcaatcggagtgatgtagcacaggtatat
ttgttgctggagaggtggtctcgtctcaacccagagcaggctatggagctccttcatttc
cagtatgctgatttagcagtgagacagtatgctgtaacctgcttggaatcattgagtgat
aataagctactcatgtatttgctccagctggttcaagctcttaaatttgagccgtatctt
gactgccccctggcagagtttctcctgaagaaagctcttagcaataaatcaattggacac
tatcttttctggtatctcagagctgaaatgcatctacctattgtgtcagtacgttatggt
ctcattcttgaggcttattgtagggggtgtggccgctacagagagtcattagccaagcag
gttgatgctcttggtaagtggaagcaggtgactggtgagctccagaaggtgcagaaagcg
aaaaagtctaaggctgtggacgagagagatttcttgaggactcctcatcttctgaaggca
atggaagaccttcggtctccgctaaatccagccttgatgcttaaaaacctccttccagat
aaatgtaaagtgatggacagcaagatgaggcccctttggctatcattcgtcaacatggat
ccactcggcggtactgtactacagatattcaagaacggagatgatctaaggcaagacatg
ctgaccctacaagttatgaacattatggacaacgtctggcgtgaggccggcctagattta
agaatgaatccttatgcttgtttgtcgatgggtgaccaggttggtctgattgaggtggtg
ttggactccacaactatagctaagatacagaagcagcagagtggagcaagaggagccttt
gataaaaagttgctgtactcctggttgaagagtaagaataaatctcaagcagaattaaat
aaagcagttgataacttcacattgtcatgtgctggtagctgcgtagccacttatgtactt
ggtataggggataggcactcagacaatataatgctcaaatctaatggacaattggttcat
attgattttggtcacttccttggtaactttaagagcaagtttggcgtgaaacgtgagaga
gtgccctttgtccttactgacgattttattcacatcattaccagagaagaagggaagaca
tcatttgagtttgtcaagtttaagaacctttgcgagaaggcttttatgctcttacgtcag
aaaggagatctcttcatcacactcttcactatgatgctctccactggtattcctgaactt
aggacgatcgatgacattcgctacatcagcaatgctctttgtctttctaaaaatgatgac
caggcaaaggaggatttccgtaagaagttggcagaggctgtcaagcattcttggagtgtc
agtattaactggtatttccataatgtggcacgtactgggaattaa

DBGET integrated database retrieval system