KEGG   Amphimedon queenslandica (sponge): 100640238Help
Entry
100640238         CDS       T02284                                 

Definition
tyrosine-protein kinase SYK-like
Orthology
K05855  
spleen tyrosine kinase [EC:2.7.10.2]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     100640238
Protein kinases [BR:aqu01001]
 Tyrosine protein kinases
  Syk family
   100640238
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 577 aa AA seqDB search
MADLSNEPWYHGRISRSDAEQILTQCGGVDGSFLVRDSLTTSGEYVLSLCHQTKRYHYLI
SRKPDGTLAIQDGTKFDSPVDLVRYHGQKIDGLLTTLVYPCRRPPGQPPQGYRFITHDEM
QQAMREGALLLGYQEHQINDALLKRRSAFEQLVGGILHRRQQWFHGPISRDESELRLRQF
GLKDGLFLVRERTQVNSFALCISFKMKIYHYLLDMNTLGQLSIENGRKFENLLQVVDHYS
RTPDGLLCSLGDYCPVRGFEESKGKSAPRVRHGPRRIEDSELETQGELGAGTFGTVRQGV
YRPLSGEPPVKCALKFLKPTEELPNQKAEILREADAMAMLDHPNIVRLYGICVGDPIRLV
MELAACGPLNKFLRKHVGFPVLKIVNMIIQVAKGMEYLEKTRFVHRDLAARNVLVVDDDN
VKISDFGMSRAIGGGSEYYRAETAGRWPLKWYAPECIYYAKFDSKSDVWSYGVTAWEAFS
YGAKPYQGMRGTDIMQMLEGNERLDRPDKCPQAIYEIMLRCWSWRPEDRPSFGELVSTIS
EIAQFHMTQSPLSRPPMRPPRPGHNPGLPPGTPPRRM
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggctgacctaagcaacgaaccttggtaccatggtcgtatatcgcggagtgatgctgaa
cagatcttgacccaatgtggcggagtagacgggtcttttctagtcagagacagtctcacc
acgtcgggcgaatacgtcctctctctctgccaccaaacaaagcgatatcactacctcatc
tctcgaaagcccgatggaacccttgccatacaagacggaaccaagtttgattctccagtc
gaccttgttcggtaccacggtcaaaaaatcgacggtctcttgaccacgttggtatatccg
tgtcgtaggccgccgggccagccaccgcaaggatataggttcattactcatgatgaaatg
cagcaggcaatgagggaaggagcactgctactggggtatcaggaacatcaaatcaatgat
gctctgcttaagaggaggagtgcctttgagcagctggtcggtggcatactacacaggcgg
cagcagtggttccatggtcccatatctagggatgagagcgagctcaggttacgccagttc
ggcctaaaagacggtcttttcctcgtgagagagagaacccaagtcaatagctttgcttta
tgcatctcgttcaagatgaagatctatcattatctccttgacatgaacacactcggtcag
ctctcaatagaaaatggcagaaagtttgagaacctcctgcaagttgttgatcattattct
cggacccccgacggcctcttgtgctctctgggcgactattgtccggttagaggatttgag
gaatccaagggtaaatcagctcctcgagtcagacacgggccacggagaatagaagacagt
gaactcgaaacacaaggagaattaggtgctggtacatttggtacagtcaggcagggcgtg
taccgccctcttagtggggaacctcctgtcaagtgtgctctcaagtttttgaaacccacg
gaagagcttccgaatcagaaagccgagatactgagagaggctgatgcaatggccatgctt
gatcatcctaatatagttagactttatggtatatgcgtaggtgatccaattagactagtg
atggaacttgctgcctgtggccctttgaacaagtttctacggaagcatgtcggttttcct
gttttaaagattgttaatatgattatacaagttgccaagggcatggaatatttagaaaag
actaggtttgttcacagggatcttgctgcccgcaacgtgttagtggttgatgatgataat
gttaagattagcgactttgggatgtcccgagctattggaggaggctcagaatattacaga
gcagagactgctgggcggtggccattgaagtggtatgctcccgagtgtatttattatgca
aagtttgatagcaagtctgatgtgtggagttacggagtcactgcttgggaagctttttca
tacggagccaaaccttatcaggggatgcgtggtactgacattatgcagatgcttgaaggg
aacgaaaggttggatcgtccagacaagtgtccccaagcaatttacgaaataatgcttcgc
tgctggtcctggaggccggaggaccgcccctcgtttggcgagctcgtatcaacaatttcg
gaaatagctcaattccatatgacccagtcccctcttagtagacccccgatgcgccccccg
agaccgggtcataatcccgggctgccccccgggaccccgcccagaagaatgtaa

DBGET integrated database retrieval system