KEGG   Amphimedon queenslandica (sponge): 100640241Help
Entry
100640241         CDS       T02284                                 

Definition
putative glycerol kinase 3-like
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:aqu00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 555 aa AA seqDB search
MEDSKPRLVGAIDVGTGSSRFLIFNENLELKFSLKEKAHRKELGQHSPKEGWLEQDPIEL
LESVRLCIGGVADSLRLEGTPISSIHGVGITNQRETTILWDKLTGVPFYNAIVWSDNRTR
QLADALIASTPNNNKDYLRPKCGLPIHPYFSALKIRWLIDNVEEVRIAVAGKTCLFGTVD
SWIIWNLTGGISGGCHVTDVTNASRTMLMDLQTCKWDTELCSFFGIPMSILPEIRSSSEV
YGHISEGPLKGIPISGCLGDQQAALVGQRCFKKGDAKNTYGTGCFLLYNTGLVPVRSSNG
LLTTVAYKMGSEADVHYALEGSVAMAGQCVRWLRDNMKFFTDAQEIERLAESVHDTAGVY
FVPAFSGLYAPHWQSDARGLIIGLSSYTNKGHICRATLEAVCFQSREILEAMNQDSELPL
ASLKVDGGMTVNKLLLQLQADLLGIPVEKEDMSETTVLGAAIAAGIGVGVWPNQLDSIPQ
SMAVTLFNPSIDHDNRDSRYYRWKEAVKRCMHWEGNEKEIQNNGRWKRERKVGVVGVGVA
AAVLAAALLIYWRRH
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggaagatagtaagcctaggttggttggagcaattgatgtagggacgggtagctccagg
ttccttatcttcaatgaaaatctagagctaaagttcagtttaaaagaaaaggcacataga
aaagaactaggacagcattcaccaaaggaagggtggctggaacaagatcccattgaacta
ttagagtcggtgagactatgcattggaggtgtggccgactcactccgtcttgagggcacg
cccatttcttccatacatggtgttgggattactaatcaaagagagactaccatattatgg
gacaagctaacaggagtgccattttacaatgcaatagtttggagcgataatagaacaaga
cagctggcagatgcactgatagcctcaacacctaataataacaaggattatctaagaccc
aagtgtggtttgcccatccatccctacttcagtgcactaaagatacggtggctgatcgat
aacgttgaagaagtaagaatagctgtcgccggcaagacttgtctctttggtacagtggac
tcatggataatatggaatctgaccggaggcatatcaggaggttgtcacgtgactgacgtc
accaatgctagtcgaacgatgctaatggatctacagacctgtaagtgggacaccgagtta
tgcagcttttttggtatacccatgtctatattgccagagataaggagctcatctgaagtg
tatgggcatatatctgaaggtccattaaagggaataccgatctccggatgtttgggggat
cagcaagctgccctggtaggtcagagatgctttaagaaaggtgatgctaagaacacttac
ggtactgggtgcttcttactctacaatactggcttggttccagtgagatccagcaatggg
ttgctaactacagttgcgtataagatgggatcagaagcagatgtccattatgctttagag
ggttctgtagcaatggccggacagtgtgttaggtggctaagagataacatgaagtttttc
actgacgcacaagaaattgagaggctggcagagtctgttcatgatacagctggtgtatat
tttgttccggcattttctggtctatatgcacctcactggcagtctgatgccagagggttg
ataatcggtttgagcagttatactaataaaggtcacatatgccgtgcaacactcgaggca
gtttgctttcaatctcgtgaaatactggaggccatgaatcaggattctgagctaccacta
gcttcccttaaggtcgatgggggcatgacagtgaataaattattattacaattgcaagct
gatttactgggaataccagtggagaaagaggatatgtctgagaccacagtgttaggtgca
gctatagcagctggcattggcgtgggggtgtggcctaaccagcttgacagtattcctcag
tcgatggctgtcacattatttaatccatcaatagaccacgacaacagagactcgagatat
tacaggtggaaggaagctgtaaagcgttgcatgcactgggaaggaaacgagaaagaaatt
caaaacaatggaaggtggaagagagaacgaaaagtgggtgtggtgggagtaggcgtggct
gcagcagtattggcagctgctttgctcatttattggagaaggcattaa

DBGET integrated database retrieval system