KEGG   Amphimedon queenslandica (sponge): 100640460Help
Entry
100640460         CDS       T02284                                 

Definition
putative ascorbate peroxidase-like
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 394 aa AA seqDB search
MSSSFCVVFLFSYLSLAFSQSVTVETEARAIADINAFIANNTNTGNQPEINNPAAKLVRL
AFHDCPGGCDGCLNFENPENNGLMETYTIINGIFDRNGYAAEGMSRADFVALAGVIAIEA
ASMRQDCRMMPPNSTCPLVPTMTLKYGRRDCQTSPRTDDIEPFPVAHGDLSHVLMYFRDN
MNMSTRETVAIIGAHSLGTTRLQNSGFRGPWAPPTDRFDNGFYRILFGGGNARWMQEEVN
DTRSSVFPDSRYQWTRPGPGNGGPGPGNGGGPVIMLNSDMALLRDIDPDSDGRESNASCR
MNSNNCEESMLTFNMVREFAMNNSAFIEAFGPAFQKLIETGYHGTNALYTAEEVVPTSSS
PMPTPTESSTPSAGVGLKAVLLLTLSLFVLAVFA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagcttctgtgttgtttttctcttctcttacctttctcttgctttctctcaa
tctgtgacagtagagacagaggccagagctattgctgacattaatgctttcattgctaac
aacaccaacactgggaatcaacctgaaattaataatccagctgctaaactagtccgtctt
gcctttcatgattgcccaggtggatgtgatggctgcctcaactttgagaatcctgaaaac
aatggactaatggagacatacactattatcaatgggatatttgatcgtaatggctatgca
gcagagggaatgtcacgagctgattttgttgctttagctggtgtcattgcaatagaagct
gcatcaatgcggcaagactgtagaatgatgccacctaattcaacctgtccacttgttcct
actatgacactcaaatatggtcgcagagactgccaaacgtctccaagaacagatgatatt
gaaccatttccagttgctcatggcgacctgagtcacgtactgatgtactttcgggataac
atgaacatgagcactcgtgagactgtagccattataggagcccacagtctggggactacc
agactacagaacagtgggtttagaggcccttgggctccaccgactgataggtttgataat
gggttctatcgtattttatttggtggtggtaatgcaaggtggatgcaagaggaggtcaac
gacactcgtagctcagtgttccctgattcaagataccaatggactaggcctggccctggt
aatggtggacctggtcctggtaatggtggtggacctgttatcatgttgaacagtgacatg
gctttactgagggacattgatcctgattctgatggacgtgagtctaatgcttcttgtcga
atgaactcaaacaattgtgaagaatcaatgctcacctttaacatggtgagggagtttgcc
atgaacaacagtgcattcatagaggcatttggacccgccttccagaaactaatagaaact
ggttaccatgggactaatgctctttatactgcagaagaagttgttcctacatcatcatca
cctatgccaacccctactgagtcatccactcctagtgctggtgttggcttgaaagcagtt
ctgctactcactctatctctctttgtactagctgtctttgcttga

DBGET integrated database retrieval system