KEGG   Amphimedon queenslandica (sponge): 100640460Help
Entry
100640460         CDS       T02284                                 

Definition
(RefSeq) putative ascorbate peroxidase
  KO
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     100640460
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 394 aa AA seqDB search
MSSSFCVVFLFSYLSLAFSQSVTVETEARAIADINAFIANNTNTGNQPEINNPAAKLVRL
AFHDCPGGCDGCLNFENPENNGLMETYTIINGIFDRNGYAAEGMSRADFVALAGVIAIEA
ASMRQDCRMMPPNSTCPLVPTMTLKYGRRDCQTSPRTDDIEPFPVAHGDLSHVLMYFRDN
MNMSTRETVAIIGAHSLGTTRLQNSGFRGPWAPPTDRFDNGFYRILFGGGNARWMQEEVN
DTRSSVFPDSRYQWTRPGPGNGGPGPGNGGGPVIMLNSDMALLRDIDPDSDGRESNASCR
MNSNNCEESMLTFNMVREFAMNNSAFIEAFGPAFQKLIETGYHGTNALYTAEEVVPTSSS
PMPTPTESSTPSAGVGLKAVLLLTLSLFVLAVFA
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgtcctccagcttctgtgttgtttttctcttctcttacctttctcttgctttctctcaa
tctgtgacagtagagacagaggccagagctattgctgacattaatgctttcattgctaac
aacaccaacactgggaatcaacctgaaattaataatccagctgctaaactagtccgtctt
gcctttcatgattgcccaggtggatgtgatggctgcctcaactttgagaatcctgaaaac
aatggactaatggagacatacactattatcaatgggatatttgatcgtaatggctatgca
gcagagggaatgtcacgagctgattttgttgctttagctggtgtcattgcaatagaagct
gcatcaatgcggcaagactgtagaatgatgccacctaattcaacctgtccacttgttcct
actatgacactcaaatatggtcgcagagactgccaaacgtctccaagaacagatgatatt
gaaccatttccagttgctcatggcgacctgagtcacgtactgatgtactttcgggataac
atgaacatgagcactcgtgagactgtagccattataggagcccacagtctggggactacc
agactacagaacagtgggtttagaggcccttgggctccaccgactgataggtttgataat
gggttctatcgtattttatttggtggtggtaatgcaaggtggatgcaagaggaggtcaac
gacactcgtagctcagtgttccctgattcaagataccaatggactaggcctggccctggt
aatggtggacctggtcctggtaatggtggtggacctgttatcatgttgaacagtgacatg
gctttactgagggacattgatcctgattctgatggacgtgagtctaatgcttcttgtcga
atgaactcaaacaattgtgaagaatcaatgctcacctttaacatggtgagggagtttgcc
atgaacaacagtgcattcatagaggcatttggacccgccttccagaaactaatagaaact
ggttaccatgggactaatgctctttatactgcagaagaagttgttcctacatcatcatca
cctatgccaacccctactgagtcatccactcctagtgctggtgttggcttgaaagcagtt
ctgctactcactctatctctctttgtactagctgtctttgcttga

DBGET integrated database retrieval system