KEGG   Amphimedon queenslandica (sponge): 100640617Help
Entry
100640617         CDS       T02284                                 

Definition
filamin-C-like
Orthology
K04437  
filamin
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100640617
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 1768 aa AA seqDB search
MSSLVEEMESKTSLDAEWKRIQEKTFTRWCNEQLKYREIVLSDLAEGLSNGVNLIHLLEL
LSTKQLGRYNKKPRVHAQRMENVDMALNFITKTEKIRLVNIGSGDIVGGNKKLILGLIWT
LILHYQINLGLGLNDKSKNEKMSAKKALLGYINSKIPEKNIKDFTSDWNDGTAVAALVDG
IAPGLCPEAETMDPKDALANAQHAMKLAEDWLSVPMVLGPEDMVNPNVDELSMMTYLSQF
PDAKLKPGAPIKIKSSPNKVKLTGPGIEGDGLKTGLPAVFHADATTAGSGKLEASVDGPE
GLADVRIQDNKDGTYTCSYVPPTDGAYNVNVLWGGLPVTTDPIKVHVSPGTNALACRAYG
PGVEGIDLKEGTSTEFFVETTGAGEGELSIDVRGPKGPLDSVTVQQDTEDKDRYCVQYVP
PTPSQYIIEVKFARLHIKDSPFKVRAVPDKPDATKCFAEGPGVTDELQVDEETWFRVYTK
GAGRGDLVANARGLHGEVIVLSEEVEPGVTQYTYTPKESGDLVITVKYGGFHIQGSRFRV
QVKPPPRPNKCIASGPGLAPKGVRVNQSTNFHVKTKDAGSGNVDVSITGDGDIELPYNQL
PSSQGIDYAYTPVDPGQYTVDIKFADHDIPGSPFPVSITDPSKVDITGPGINGEPILVGV
PHKYNIISKGAGPGDVACHVSDSKSLPEVREIDADNFEILYTPSGTGPKKMNVTFNEAPI
PKTPIRLNVYDPSKVLAKGPGLEPGNKTGDTTHFNVDKRKAGEGQLAIQIKGPTEPPLVI
KDQANDIVSCEYTPQVEGDYAVSVLLEDSHIPGSPFNVFIKQKANPSLVIATGDGLNETG
LTTDTDAEFFVDYTAAGDGELQVHIEGPAGGVEFNEEEMEPGINKYTYHTDPDENGRYVV
QIKFAEEDIPDSPFTVNVKWKPDPSRVIAEGSGLEGGITKELAEFTVDLQKAGDGELEAH
IEGPCPVKINAFDSESKPVEKCLNNNGNFYLFQYFPELPGSYTIPILFNKAHVPGSPFKA
VFELGTDPSKCLAHGPGLREHGVRTGDPGNFTIDATMAGPGAVDAIVEIPGSMPVPPIIT
SNNDGTYSVLYNPHRVGTYEICVTFADVSIPGSPFLVNVTDPSKVLLQGPGCSGEGPAHH
PMGSPVLWVANTQKAGPGVFEAFVSLEELIDYDEEREEEKVVITEDGPMYNIEFNPSKPG
PYVLVVSYSGNRIDLEPAIEVFDSERVQVYGPAFDGVDLGEDALFYIDCSKAGNAQLGIE
LYGPANDSLELLEGEGTGFKLNASSPGVYEVDISYGSNPVPGSPFSIPVRDITKVVISGS
GVTGEGARVGKPAFVSVDTSDSGPAPLEVKVTSPSGDSEMVQLEKSSDNQDLYEGSYTPK
EPGHYCIEVDYNETPLPESPYQAPIGAPNQVTINWPEHSFVDIDNIAVCQTENAGPGVIE
AVIKGPGSSTWSVSPSSNGSGQVLHYSPDAPGIYEAEILYNGFPVQEKPVEFEAVSLSNV
SVSGPGIRSGILAREETYFNVNTEKAGKGDLAISIKSPEGDQLPVGVTDETQSSHRITYT
PVVAGDHVIVVSYNEREIEASPICVSIADPNQVVCTGDGLSRATVGEAALFKADVTRAGK
GELRVNVDGPEPVDEVDCSDNHDGTHTVSYIPTKPGVYSVDVKYNDVSVDSSPFTVECRR
PSPDATKCIVSGIENPGEFTVDCKNAGGSGLLEVGVSGSYVPVEFVSVRHNGDYTFVVSY
DVSIPGETTISVKWHNQHLEGSPFIVFI
NT seq 5307 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcactagtcgaagaaatggagtccaagactagcttggacgccgaatggaagcga
atacaagagaagaccttcacgcgttggtgcaacgagcagctcaagtatagggagatagtg
ttgtcggatctggctgaaggcctctccaatggagtcaatctcatacacttgctcgagctt
ctctccactaagcagctgggtagatacaacaagaagcctcgagtccatgcacaaaggatg
gagaatgtcgatatggctctcaacttcatcacgaaaacggagaaaatcaggcttgtcaac
atagggagtggagacatagttgggggcaacaaaaagctcatactgggtctaatttggacg
cttatacttcactatcagattaaccttggccttgggctgaatgataaatcaaagaacgag
aaaatgtcggcaaagaaggcactccttggatacataaattcaaaaataccggagaaaaat
atcaaagatttcacttctgactggaatgacggtacagcagtagctgctctggtggacggg
attgctcctggactgtgtccagaggccgagacaatggatccaaaagatgctctagcaaat
gcacagcacgcaatgaagctagctgaagactggctgagtgtcccaatggtattgggcccg
gaagacatggtcaatcctaacgttgacgagttgagtatgatgacttacctctctcagttt
ccagacgcaaagctcaaaccaggcgccccgataaaaatcaagagctccccaaacaaagtg
aaactgaccggccccgggatagaaggagacgggctcaagacgggtctacctgccgtgttc
catgccgatgcaacgactgccggatcgggaaaactagaagctagcgtggacgggccggaa
ggtttggccgatgttcgtatacaagacaataaagacgggacttacacttgctcttacgtc
ccgccaactgatggagcgtacaatgttaacgttctatggggaggactcccagtcactaca
gatccaatcaaagtacatgtatcacctggtaccaatgcattggcctgccgtgcgtacggg
cctggagtagaaggcattgatcttaaggaagggaccagtactgagttttttgttgagact
actggagccggggaaggagaactgagtattgatgtacgtggacctaagggaccactggac
tcagttactgtacaacaagacactgaggataaagatcgctattgtgtacaatatgtacct
cctactccatctcagtatatcatagaagtgaaatttgccaggctccatattaaagacagt
ccgtttaaagtacgggcagtacctgacaaacccgacgcaacaaagtgctttgccgaaggt
cctggagtgacagacgagctccaagtcgatgaggagacctggttccgtgtttacactaaa
ggagccggacgaggcgaccttgttgctaatgctcggggactccatggagaggttatcgtt
ttatcagaagaagtagaaccgggagtaacacagtacacctacactcctaaagaaagcggg
gatctagtcataacagtcaagtatggtgggttccacattcagggcagtcgattccgagta
caagtaaaacctccaccgagaccaaacaagtgcatagcctcaggtcctggcctagcacct
aaaggtgtccgtgtaaaccaatctactaatttccatgtcaaaaccaaagatgctgggagt
ggaaatgtcgatgtctctataactggagatggcgatattgagctaccatacaaccaatta
ccaagcagtcagggtattgactatgcatatactccagttgatcctggtcagtacactgtt
gatataaagtttgctgatcatgatataccaggcagcccgttcccagtctccattacagat
ccatctaaagtagacatcactgggcctgggattaatggcgagccaatattagtgggggtc
cctcataaatataacatcatttctaagggggccgggcctggtgatgttgcttgtcacgtt
tctgattctaaaagtctccctgaagtgagagagattgatgctgataattttgagattctt
tacactccaagcgggactggtcctaaaaaaatgaacgtgactttcaatgaggcaccaata
ccaaaaaccccaatacgactcaacgtctatgatccctctaaagtccttgctaaaggccct
ggtctcgagcctggtaataaaactggagacacgactcatttcaacgtcgataaacgtaaa
gcaggagaaggtcaattggccattcaaataaaagggccgacagagccgcccctggtcatc
aaagatcaagctaatgatatagtaagctgcgagtacacacctcaggttgaaggtgattat
gccgtttctgtattacttgaagactctcatatacctggtagcccgtttaacgtttttatt
aaacagaaagctaacccatcactagtgattgctactggagatggtcttaatgagactgga
ctaacaacagacactgatgcagagttttttgtcgactacactgctgctggagatggtgag
ctacaagtacacattgaaggcccggcgggcggagtcgaattcaatgaagaagagatggag
cctgggatcaacaagtacacctatcatactgacccggatgaaaatggccgctatgtcgtg
cagataaaatttgccgaagaagacataccagactctccgttcacagtcaatgttaaatgg
aagccagacccttctcgtgttattgccgaaggctctggacttgagggtggaatcacaaaa
gaacttgctgagtttacagtcgaccttcaaaaggccggagatggtgaattagaagctcat
atcgaaggaccttgccccgtgaaaattaatgcgtttgattccgaatcgaaaccagttgaa
aaatgcctgaacaacaatgggaatttttacttgtttcaatacttcccggaactaccaggc
tcctatacaatacccattttgtttaacaaagcacacgtaccagggagtccctttaaagcc
gtgtttgaactcgggacggacccttcgaaatgtctcgctcacggcccggggctcagagaa
cacggagtgaggaccggtgacccaggaaactttacgattgatgctacaatggcaggacct
ggggctgtggacgctatagtcgagataccaggaagcatgccagttcctcccatcattacc
agtaataatgatgggacttacagcgtgctttataacccgcacagggtcgggacttatgag
atatgcgtgacctttgctgatgtatctataccaggctcacctttccttgtcaatgtcact
gatccaagtaaagtcttattacaaggaccagggtgtagtggtgaagggccggctcaccat
ccaatgggatctcctgtactatgggtagccaacactcagaaggctggccctggagtattt
gaagcttttgtgagcctcgaggaattgatagactatgatgaagagagagaagaagagaaa
gttgtcattacggaagatggcccaatgtacaacattgaattcaatccgagcaagcctggc
ccatacgtgcttgtagtctcttattctggtaatagaatagacttggagcccgccattgaa
gtgtttgactctgagagagtccaagtgtatgggcctgcttttgatggagttgatcttggt
gaggatgcattgttttatattgattgctcaaaagctggcaatgcacagctggggattgag
ttatatggacctgctaatgactcacttgagctactggaaggagaagggacaggattcaaa
ctaaatgcttcttcaccaggcgtatacgaggttgacatctcgtatggttccaaccctgtc
cccggtagccctttctctataccagttcgagatataactaaagtcgtcattagtggttcg
ggggttacgggagaaggggcaagagtgggcaagcctgcctttgttagtgtcgataccagc
gactcaggacccgctcctcttgaagtaaaggtcacctctccttctggtgactctgaaatg
gttcaattggaaaaatcgagcgataaccaagacctttatgagggctcttatactcctaag
gagcccggccattactgcatcgaagttgattataacgagactccattaccagagagccca
tatcaagcaccaataggagcccctaatcaagtgaccattaactggcctgagcattcattt
gttgacattgataatattgccgtatgtcagacagaaaatgctggtcctggtgtaattgaa
gctgttattaaaggacctggctcatcaacttggagcgtgtccccatcaagcaatgggtct
ggacaggttcttcattattctccggatgccccaggaatatatgaagcagagatactttat
aacgggtttcctgttcaagaaaaaccggtagaatttgaagctgttagtcttagcaatgta
tccgtatcaggcccagggataagatcagggatacttgccagagaagagacatatttcaat
gttaacactgagaaggcaggaaagggggatcttgcaataagcatcaagtcaccagaggga
gatcagctaccagtgggagtaactgatgagacccaatcctctcacagaatcacttacacg
ccggtggttgctggtgatcacgtcattgtcgtgtcttacaacgaaagggaaattgaagcc
tcaccaatatgcgtatctattgctgatcctaatcaagtagtgtgtactggtgatggtctc
agtagggctacagtaggagaagctgctctctttaaggctgacgtgactagagctggtaaa
ggagagctgagagtgaatgtggatggaccagaacctgtagatgaagttgattgctctgat
aatcacgatgggacccacactgtctcttatattcctacgaaaccaggcgtctatagtgta
gacgtgaagtataatgacgtttccgttgattctagtcccttcacagttgaatgtcgcaga
ccatcacccgatgctactaaatgcatagtttctggcatagaaaacccaggagagtttact
gttgattgcaaaaacgctggagggagcggtcttttggaagtaggcgtgtctgggtcttat
gttccagttgagttcgtgtccgtgcgtcataacggtgactatacttttgttgtgtcttat
gatgtcagcattcctggggagacaacaataagcgtcaagtggcacaatcagcaccttgaa
gggagtccttttatagttttcatatga

DBGET integrated database retrieval system