KEGG   Amphimedon queenslandica (sponge): 100640653Help
Entry
100640653         CDS       T02284                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100640653
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 148 aa AA seqDB search
MWLSNTGQHVAESRETLSFWQQVASPHQRTKDNFTFKCHRSVVTTAGQTQDIFAVNDIAF
HPTHGTLATVGSDGRYYFWDKDARTKLKHSEAMDQPITSCCFNHSGLVFAYAVSYDWSKG
HEHYNPAKKNYIFLRQANEDLRPRTKKR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgagcaacactgggcaacatgttgcagagagtagagagactctcagcttctgg
caacaagttgcctcaccacatcaaagaactaaggataatttcacttttaaatgtcatcgc
tctgtggtaactacagctggacagactcaagacattttcgctgtaaacgatatagcattt
caccctactcatgggactctggctacagttggctcggatggtagatattatttctgggac
aaagacgctaggacaaaattgaaacattctgaagctatggatcagccaataacgtcttgt
tgtttcaatcacagtggacttgtatttgcatacgctgttagttatgactggtcgaagggc
cacgagcactataatcccgccaaaaagaattacatatttttgcgtcaggcaaacgaagat
ttaagacctcgtaccaaaaaacgttaa

DBGET integrated database retrieval system