KEGG   Amphimedon queenslandica (sponge): 100640670Help
Entry
100640670         CDS       T02284                                 

Definition
1,4-alpha-glucan-branching enzyme-like
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:aqu00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 690 aa AA seqDB search
MTEKQKEPLLDASRPPQLERLFAGDGYLTSFEGDLLLRWSRYATLRNSIIKNEGSLAEFA
TGYNKHGLRQLPNGDIEYLEWVPNGETVSLAGDFNKWDPSAHVCTHLEYGKFYLKLKASE
NGTPAIPHNSQVKVVIKTQDGQTLWRMPPWTRYTIQNKDLVYIPRHWAPPTPYKWVHGHP
PKPTSVKIYEAHVGISSPEPKIASYKYFADNVLPRIADLGYTCVELMAVMEHAYYGSFGY
HVTCFHAPSSRYGNPDELKYLVDTAHGLGLSVILDVVHSHAARNVDDGLNRFDGSDACYF
HSGPRGDHTLWDSKIFNYEEWEVLRFLLSNLRWYIEEYRFDGFRFDGVTSMLYHHHGIGT
GFSGDYKEYFNMSVDLSALVYLMLANSLLHELYPFVITIAEDVSGMPTLCRPVEEGGVGF
DFRLAMAIPDMWIKLLKEEKDEDWNIESIWWTLTNRRYHEKCIAYAESHDQALVGDKTLA
FWLMDAEMYSNMSTVAPRTIVIDRGMALHKMIRLVTMSLGGEAYLTFIGNEFGHPEWLDF
PRKDNGFSYKYARRQFNLVDDKLLRYHFLYNFDRDMIKLETDYPFLSSPPAYVSRKHNGD
KVLVHERGVASTVFVFNFHPTQSFSDYRIGVYYPGTYRIVLNSDRKEYDGHDRIDESLDY
VTSEGEFDGRPHSLYLYLPSRTALVLARKN
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgacggaaaaacagaaagagcccttgttggatgcttctcgtcctccccagctggagaga
ctttttgcaggtgatggctacctcacttcctttgagggtgacctcctcttaagatggagt
cgctatgcgaccctaaggaacagcataataaagaatgaagggagtctggctgagtttgca
accggttataataagcatggtctgaggcagctgcccaatggggacattgaatatcttgaa
tgggttccaaatggagagacggtgtcacttgccggagacttcaataaatgggatccctcg
gctcacgtctgcactcaccttgagtacgggaagttttacttgaaactcaaagcgtccgaa
aatgggaccccagccatacctcacaattctcaagtcaaagtagtcataaagacacaagat
ggccagaccctttggaggatgcctccttggactcgttacactattcaaaataaggacctc
gtctacatccctcggcactgggccccgcccacaccatacaagtgggtacacggtcaccct
cctaagccgaccagtgttaagatatacgaggctcacgtgggaatatcttctccagaacct
aagattgctagttataaatattttgctgataatgttctcccaaggatagccgatttgggt
tatacttgtgttgagctgatggcagtcatggaacacgcctactacgggagctttggatat
catgtcacttgcttccatgccccctcaagtcgctatggtaacccggatgagctcaagtac
cttgtagatactgcccacggactggggctgtctgtgattttggacgtggtacatagtcac
gctgctcgtaacgttgacgatggattaaaccggtttgacgggtctgacgcttgttatttt
cacagtgggccacgtggggaccacaccctctgggacagcaagatattcaattacgaggaa
tgggaggttcttcgtttcctcctctccaatctccgctggtatatagaagaataccggttt
gacgggtttagatttgacggagttacatcaatgctctaccatcaccatggtatcggtact
gggtttagtggcgattataaagagtatttcaacatgtccgttgatctcagtgctctggta
tacctcatgctggccaatagtttattgcatgaattgtatccttttgtaataactattgct
gaggacgtatcaggtatgcccacattgtgtcgtcctgttgaagaaggaggagtgggattt
gacttcagactagcaatggctataccagacatgtggatcaagctactcaaagaggagaaa
gacgaggactggaatatagagtcaatatggtggacactaaccaacaggaggtatcacgag
aagtgtatagcatatgccgagagccatgaccaagcattggtaggcgataagaccctggcc
ttctggctgatggatgccgagatgtactccaatatgagcactgtagctcctcgtactatt
gtcattgatagggggatggcccttcataagatgattcgattggtcacgatgagtctaggg
ggcgaggcctacctgacttttatcggtaatgagtttgggcatcctgaatggctggatttt
cctcgtaaggataatgggtttagttacaagtacgctaggcgtcagtttaatttggtcgat
gacaagctactccgctaccattttttgtataattttgatcgcgatatgattaaacttgag
acagactatcctttcctctcgtctccgcccgcttacgtcagcagaaaacacaatggagac
aaggttctcgttcacgagaggggcgtggcatcgactgtctttgtattcaactttcatcca
actcagagtttttcagattatcgcattggcgtctattaccctggtacctatagaatagtc
cttaattccgaccggaaggagtatgacggtcacgataggattgatgagtccctggactat
gtgacaagtgaaggagaattcgacggtcgacctcattctttgtacctgtacctaccatca
agaactgctctagttctagcaagaaagaactga

DBGET integrated database retrieval system