KEGG   Amphimedon queenslandica (sponge): 100640738Help
Entry
100640738         CDS       T02284                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aqu01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aqu00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aqu04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 308 aa AA seqDB search
MVDMFVLFLSSLLLASAPVLADPVPLVMWHGMGDTCCFPFSMGALMKLVEKQVPGIYVQS
IEIGNSISDDELNGFFMGAEKQIDIVCKNLSANPKLQQGFNVIGFSQGGQFLRGLVQQCP
NVTVRNLISVGGQHQGVYGFPRCIGTNVTLCNEMRRLLNIGAYNKLVQDILVQAQYWHDP
LNEDEYKKKCVFLPDLNQENTYNPNYKLRLLTLKNLILVKFLEDEMVQPRESEWFGFYKP
GQAVETYTLFDSDLYKNDLLGLKTLNDTGRLHFLGAPFDHLKFTEQWFIDNLIPFINVQF
DEDEKKRD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatgtttgtcctgtttctctcctctcttcttcttgcttctgccccagtgctg
gcagatccagtcccactggtaatgtggcacggtatgggcgacacttgctgctttcccttc
agtatgggcgccctcatgaagctggtagagaagcaggtccctggaatatacgtgcaatcc
attgagataggaaacagcatatccgatgatgagctgaacgggtttttcatgggagctgag
aagcagattgatatagtttgcaagaatctttcggctaatcctaaactccagcagggcttt
aatgtaattgggttttcccaagggggccaatttctaaggggtcttgtacagcagtgcccc
aacgtcaccgtccgaaatctcatttcggtcgggggccagcaccagggggtgtacggtttc
ccaaggtgcataggtactaacgtaacgctttgcaatgaaatgagacgcctcctcaatatc
ggagcttataacaagttagtacaagacattttagtgcaggcccaatattggcacgacccc
ctgaacgaggatgagtataagaagaaatgcgtcttccttcccgacctcaatcaagagaat
acctacaacccaaactacaagttacgactcctcactttgaaaaaccttatactggtaaag
tttcttgaggatgaaatggtgcagccgagagagagcgaatggtttgggttttataagccg
ggacaagcagtcgagacttatactttatttgacagtgacctttacaagaatgacctctta
ggattgaagactctcaatgataccggtcggcttcatttccttggagctccttttgatcat
ttgaagttcactgagcaatggttcattgataatcttataccattcattaatgtccaattt
gatgaagatgagaagaaaagggactaa

DBGET integrated database retrieval system