KEGG   Amphimedon queenslandica (sponge): 100640738Help
Entry
100640738         CDS       T02284                                 

Definition
palmitoyl-protein thioesterase 1-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100640738
  Lipid metabolism
   00062 Fatty acid elongation
    100640738
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100640738
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100640738
Lipid biosynthesis proteins [BR:aqu01004]
 Fatty acid synthase
  Component type
   100640738
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 308 aa AA seqDB search
MVDMFVLFLSSLLLASAPVLADPVPLVMWHGMGDTCCFPFSMGALMKLVEKQVPGIYVQS
IEIGNSISDDELNGFFMGAEKQIDIVCKNLSANPKLQQGFNVIGFSQGGQFLRGLVQQCP
NVTVRNLISVGGQHQGVYGFPRCIGTNVTLCNEMRRLLNIGAYNKLVQDILVQAQYWHDP
LNEDEYKKKCVFLPDLNQENTYNPNYKLRLLTLKNLILVKFLEDEMVQPRESEWFGFYKP
GQAVETYTLFDSDLYKNDLLGLKTLNDTGRLHFLGAPFDHLKFTEQWFIDNLIPFINVQF
DEDEKKRD
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggtcgacatgtttgtcctgtttctctcctctcttcttcttgcttctgccccagtgctg
gcagatccagtcccactggtaatgtggcacggtatgggcgacacttgctgctttcccttc
agtatgggcgccctcatgaagctggtagagaagcaggtccctggaatatacgtgcaatcc
attgagataggaaacagcatatccgatgatgagctgaacgggtttttcatgggagctgag
aagcagattgatatagtttgcaagaatctttcggctaatcctaaactccagcagggcttt
aatgtaattgggttttcccaagggggccaatttctaaggggtcttgtacagcagtgcccc
aacgtcaccgtccgaaatctcatttcggtcgggggccagcaccagggggtgtacggtttc
ccaaggtgcataggtactaacgtaacgctttgcaatgaaatgagacgcctcctcaatatc
ggagcttataacaagttagtacaagacattttagtgcaggcccaatattggcacgacccc
ctgaacgaggatgagtataagaagaaatgcgtcttccttcccgacctcaatcaagagaat
acctacaacccaaactacaagttacgactcctcactttgaaaaaccttatactggtaaag
tttcttgaggatgaaatggtgcagccgagagagagcgaatggtttgggttttataagccg
ggacaagcagtcgagacttatactttatttgacagtgacctttacaagaatgacctctta
ggattgaagactctcaatgataccggtcggcttcatttccttggagctccttttgatcat
ttgaagttcactgagcaatggttcattgataatcttataccattcattaatgtccaattt
gatgaagatgagaagaaaagggactaa

DBGET integrated database retrieval system