KEGG   Amphimedon queenslandica (sponge): 100640802Help
Entry
100640802         CDS       T02284                                 

Definition
glycogen [starch] synthase, muscle-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100640802
Enzymes [BR:aqu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100640802
Glycosyltransferases [BR:aqu01003]
 Polysaccharide
  Storage polysaccharide
   100640802
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1177 aa AA seqDB search
MELSKLSLEDHSLSEDKVVAEPFRFSFEIAWEVAHKVGGIHTVIRSKAPVTTAELGDQYC
MIGPYHEPTVKLEVEVMEPELSVTKEVVESMKKEGVKVVYGRWLIEGYPKVILFDLGSSY
WRLSQWKQEIWDLCHIGIPDNDGESQDAVVFGFLTFWFISEFVRRIPGPSPLVVAQFHEW
MSGIGLLMLRLKKIPVATIFTTHATLLGRYLCAGKADFYNNLPFFNVDKEAGDRQIYHRY
CLERAAATICHTFSTVSKITAEEAEHLLKRKPDVVLPNGLNVIKFSAMHEFQNLHAQSKE
KIHDFVRGHFHGHYDFDLDKTLYFFIAGRYEFSNKGADLFLESLARLNHYLKVCNSDITV
VAFFIFPAPTNSFNVASLKGQAITKQLRETVDSIQAQIGKKIYESTLRGHLPDPQTFLEK
EDIIKLKRSMFSAQRTDLPPVVTHNVLNSDSDPVLSHIRRIQLFNRREDRVKVIFHPEFL
SSTNPLFKMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFISENV
TDPPAYGLYIIDRRFKNVEESVQQLSQYLFEFCSQSRRQRIIQRNRTERLSELLDWEQLG
KYYRMARKMALKAVHPDYFKRSGAATPVHTDKFPRPLSLPPSEPPNLSEDEEDEEDEDED
EGDDYEAASSPHHSLSSSVASTDLHYASFVVTKATRAVIRKKMSKFLKVIPCCSCCNSSS
KEEPVSVKDNEVDNGEQCNQKDLQRRSCGSTTESSLDVRRKQSIVGPTKLWKFNLRQVAE
HLTKIDSDMLKSICILELQNGNWMKKDKEKLSPNIIAMINQFNQFAYFVCTEIVTEEALS
TRIMILSNYIKLMEHLQRLHNYNAMTAIKAALTNTAIHRLTDTWNGLSKRQKKKFDELSD
ILCLVSNANGILDDMVRFSTTNVPCVPYLGWLLHIIARWQTYNKLVKKSGKSHSLAIVVP
AITVASNKNEDSGVAYATLSEETTLSNGKGATGEIDKELPDEEEVAIDDEEDKEDQDTAN
SETTKDKRAKDELEGTKEVALSSAGAESITKSETEIETARPKLESNDESNTAESSRRELM
LDEMDTKTMLDPDEFVPITEADIMESLSVTRERFPVRNEASVLVMFQDFQRNCLLYDEKN
LVRQPEMDAVFNNTTILNDEQLLLISYKCKPKNDRVP
NT seq 3534 nt NT seq  +upstreamnt  +downstreamnt
atggagctctccaaattgagtctggaagaccattccctctcagaagacaaagtagtagcc
gagccttttcgtttcagctttgaaatagcctgggaagttgctcacaaagttggtggtatt
cacactgtgattaggagtaaagccccagtcactactgccgagttaggagaccagtattgc
atgataggaccctaccatgagccaaccgttaagctagaagtagaggtgatggagcctgag
ctctctgtcactaaagaagtcgttgagtccatgaagaaggaaggagtcaaggttgtctat
ggtcgctggctcattgaaggttacccgaaggtgatattatttgatttgggttcctcgtac
tggcgtctgagtcagtggaagcaggagatatgggatctctgtcacattggtatccctgat
aatgatggagagtcacaagacgctgtcgtctttggcttcttaacattttggttcatatct
gaatttgttaggcgtatccctggtccctctccgctggttgttgctcagtttcacgagtgg
atgtcaggtattggcctcctgatgctcaggttaaagaagatcccagtggcaaccatattc
acaacacacgctactctgttgggtagatacctttgtgcagggaaagcagacttttataat
aatctacctttttttaatgttgacaaggaagctggtgataggcagatatatcacagatat
tgtttggagagggcagctgctactatatgtcacacgttttctacagtctcaaagatcact
gcagaagaagctgaacatttgctaaagaggaagccggatgttgttcttcctaatggttta
aatgtcattaagttcagtgcaatgcatgagtttcagaatcttcatgctcagtctaaagag
aagattcatgattttgtgagaggtcatttccatggccattatgattttgatcttgacaag
actttgtatttttttatagctggcaggtatgaattcagtaacaaaggagctgatctcttt
ctagaatcactagctagactcaatcattatttaaaagtgtgcaatagtgatatcactgtt
gttgccttcttcatatttcctgctccaacaaacagctttaacgttgcttctttgaaagga
caagctatcacaaaacaactgagagaaactgttgattcaatccaagctcaaataggcaag
aagatttatgagagcacattgagaggacatcttcctgaccctcaaacttttcttgagaaa
gaagatatcataaaattgaagagaagcatgttctctgcccagaggacagacttaccacca
gttgtgactcacaatgtcctcaacagtgactctgaccctgttctctctcacatcagacga
atacaattattcaatagaagagaggacagggtgaaggtaatatttcatcccgagttcctt
tcatcaactaatcctttattcaagatggattatgaggagtttgtcagaggctgtcatttg
ggagtgttcccgtcatattatgagccgtggggatacaccccagctgagtgcactgtaatg
ggcattccttctgttactactaatctctctggctttggttgctttatatcagagaatgta
actgatcctccagcctacggactgtacattattgatagaaggtttaagaatgtggaggag
tcagtccaacaattgtctcagtatttgtttgaattctgttcccagtcaaggagacagcgt
atcatacagaggaacaggactgagagactgagtgagctcctcgattgggagcagcttgga
aagtattatcgcatggccaggaagatggcactaaaggctgtccatccagactactttaag
agatctggagctgcaactcccgtccatactgacaagtttcccagacctcttagtcttcca
cctagtgagcctccgaacctcagtgaagatgaggaagatgaggaagatgaagatgaagat
gaaggagatgattatgaagctgccagctctccacatcattctctctcttcctcggttgct
tcaacagatttacattacgcaagcttcgtggtaaccaaggcaacacgcgctgtcattcga
aaaaaaatgtcaaagtttctgaaagtgattccttgttgttcttgctgtaatagcagtagt
aaagaagaacctgttagtgtcaaagacaatgaagtagataatggagagcaatgcaatcaa
aaagacttacagaggagatcttgtggcagtactacagagagtagcttggatgtaaggaga
aaacaaagcattgtgggacctacaaagctgtggaaattcaatttaagacaagttgccgag
cacttgactaaaattgattcggacatgctgaaatcaatttgtatattagaactacaaaat
ggaaactggatgaagaaagacaaggaaaagctgtctcctaatatcatagcaatgattaat
cagttcaatcagtttgcatattttgtttgcactgagattgtgacagaggaggcacttagc
acaagaatcatgatactctcaaactacatcaaactaatggaacacctccaaaggcttcat
aactacaatgcaatgacagccattaaagcagccctaacaaacacagccatccacaggctc
acagacacatggaacggactttcaaaaaggcagaaaaaaaaatttgatgagttatctgac
atcctatgccttgttagcaatgctaatggtatactggatgatatggttcgattctctacc
accaatgtaccttgtgtgccttatcttgggtggctactgcatataattgctagatggcaa
acgtacaataaattggtcaagaagagtggaaagtcacatagtttggcaatagtagtaccg
gcaataactgtagctagcaacaaaaacgaggatagtggggttgcatatgcaacactaagt
gaagaaaccacattatctaatggcaaaggagctactggtgagattgataaagaattacca
gatgaagaggaggtggcaatagatgatgaagaggacaaagaagaccaagatacagccaat
agtgagactacaaaagacaaaagagctaaggatgaactggaaggaacaaaagaagtggct
ttatcatctgcaggagctgaaagtataacaaaaagtgaaactgaaattgaaactgcaaga
ccaaaattagagagtaatgatgaatcaaatactgcagaatcatctcgcagagaactaatg
ctggatgaaatggatactaaaacaatgttagatccagatgaatttgttcctatcactgaa
gcagatataatggagtcactgagtgtgacacgtgaaaggtttccagtgagaaatgaagcc
tctgtactggtcatgtttcaagactttcaaagaaattgtctgttgtatgatgaaaaaaat
cttgtcaggcaaccagaaatggatgcagtgttcaataacacaacaattttgaatgatgaa
cagctcctcttgatatcttacaagtgcaaacctaaaaatgatagagttccatga

DBGET integrated database retrieval system