KEGG   Amphimedon queenslandica (sponge): 100640804Help
Entry
100640804         CDS       T02284                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha-like
Organism
aqu  Amphimedon queenslandica (sponge)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 346 aa AA seqDB search
MGNAPGKPDVVQAFLVEAKTEFQRKWESPPAQTGKLDDFDRIKTLGTGSFGRVMLVQHKK
TSKYYAMKILDKQKVVKLKQVEHTLNEKRILSSINFPFVVNLEFHFKDNSYLYMLLEFVS
GGEMFSHLRRIGRFSESHSRFYASQIVLAFEYLHYLDIVYRDLKPENLLIDQHGYVKVTD
FGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNRAVDWWAMGVLIYEMAAGYPPFFADQPI
QIYEKIVSGKVRFPSHFTADLKDLLRNLLQVDLTKRFGNLKNGVQDIKGHSWFSSTEWIS
IYQRKIDAPFVPKTKGAGDPSNFDDYKEEVLRIAAAEKFPKEFADF
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgggaaacgcaccaggaaaaccagacgttgttcaggcatttctagtggaagccaagacc
gagttccaacgcaaatgggagagccctccagcacaaactggtaaattggatgactttgac
cgcatcaagacacttggtaccggctcctttggtcgtgtgatgctggtccagcacaagaaa
acctcaaagtactacgcaatgaagatacttgacaagcaaaaagttgtcaagctcaaacaa
gttgaacacactcttaatgagaagaggatcctgtcttcaatcaatttcccctttgttgtc
aacttagagtttcactttaaggacaattcctacctctacatgttgcttgagtttgtctcc
ggaggagaaatgttctctcacttgaggagaataggccgttttagcgagtctcattcaagg
ttctatgcttcacagatcgtgttagcttttgagtacctccactacttagacattgtctat
agagatttgaagcctgagaatcttctcattgatcagcatggctacgttaaagtaactgac
tttggttttgcaaagcgtgttaaaggcaggacttggaccctttgtggtactcctgagtat
ttggctcctgagatcatcctctccaagggatacaatagagctgttgactggtgggccatg
ggtgtccttatttatgaaatggctgctggttatccaccattttttgctgatcaaccaatt
caaatttatgagaagattgtttctggaaaagttcgtttcccgtctcactttactgctgat
ctcaaggatctcctgcgtaacctccttcaagttgatctgaccaagaggtttggtaatctg
aagaatggtgtccaggacattaagggacactcatggttctcatcaactgagtggatatca
atctaccaaaggaagattgatgccccatttgttcccaagactaaaggtgctggtgacccg
agtaactttgatgactacaaagaagaggttcttcgcattgccgcagccgagaaattcccc
aaagagtttgcggacttttag

DBGET integrated database retrieval system