KEGG   Amphimedon queenslandica (sponge): 100640908Help
Entry
100640908         CDS       T02284                                 

Definition
group XV phospholipase A2-like
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 401 aa AA seqDB search
MMYVTLALVLFAHFFSVQSTTRSPIVIVPGLLGNQLEAKLDKDSSPSILCKKKSDWFTLW
VNLDLAAPGVDECFVDNVKLRYDENTKEYYNNSGVEVRVPGFGTTDSIEYLDNSAIYKYP
YFNKFVKYFEGLGYTKGKDLVGAPFDWRFAPDQLSKLGYYDALFVLIEDTYRNNGETPVT
LIAHSLGGPISLYFLSKIAPSDWKDSTIKQYISLSGAFGGSLHVLLGIISGDVEGVFTAR
PLVLRECQRSNPSQVLLLPSTQLWKDDEVLVVQPKRNYTAFNYEELFTDISYTNGSRIYN
EVKSLISDFPPPNVTHYCYYGTDVKTIDTYIYGDSFPNGPPSGFVYGNGDGTVNARSLQT
CNLWKDKQVYPVTMKSYSKVSHFDMVSDENVLQDLGKLLST
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgatgtatgtaactcttgccttggttctttttgctcactttttctctgttcaatcaacc
acaaggagccctattgtcatagttcctggtttacttggtaatcagttggaggctaaatta
gacaaagactcatctccaagcatattgtgtaaaaagaagagtgactggttcactctatgg
gtcaatcttgatctcgctgcaccaggtgtcgacgaatgctttgtggacaacgtcaagcta
agatatgatgagaatacaaaagagtattacaataactcaggagttgaagtgagggttcct
ggcttcggtactaccgacagtattgagtatctcgataattctgccatttacaagtaccca
tactttaacaagtttgtcaagtactttgaaggattgggttacactaaaggaaaggatctc
gttggagcaccttttgattggcgatttgcacctgatcagctatcaaaattaggttactat
gatgcactatttgtgctaatagaggatacttatcgtaataatggagagacccccgtcact
cttattgcccacagcctgggaggacctatttctttgtacttcttgagtaaaattgctcct
tcagactggaaggattctactattaagcaatacataagtctctcgggtgcttttggagga
tctctccatgttctccttggaataatatcgggagatgttgagggtgtgtttactgcaagg
cctttggtacttcgtgagtgtcagagaagcaacccaagtcaagttctcctattaccctcg
acacaactttggaaagatgatgaggtactggtagtgcagcctaagagaaactacactgca
ttcaattacgaggaattgttcactgacatcagttataccaatggatcacgtatatacaat
gaagttaagagcctcatttctgatttcccccctcctaacgtgacccattattgctactat
gggactgatgttaaaaccattgatacatatatttatggagactcattccctaatggacct
ccttctggttttgtttatggaaacggtgacggaactgttaatgctcgttcgctccaaacg
tgcaatttgtggaaagacaaacaggtttatccagttacgatgaagtcctattctaaagta
tcacattttgatatggtatcagatgaaaatgtcctccaagatttgggaaagttattaagt
acatga

DBGET integrated database retrieval system