KEGG   Amphimedon queenslandica (sponge): 100640962Help
Entry
100640962         CDS       T02284                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Wnt signaling pathway
Class
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aqu04310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 171 aa AA seqDB search
MGVEQSLPLDLAKKFDPDEIKRLSRRFKRLDLNKDGSLSLDEFMSIPELQQNPLVKRVID
ILDTDRNGAIDFQEFIEGVSQFSVQGETDKKLKFAFKIYDIDQDGFISNGELFQVLKTMV
GSNLTDKQLQEIVDKTILYADKDNDGKISYEEFCDVVGGLDVTSKMVIDLK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagagcaatctttgccgcttgacctggccaagaaatttgatccggacgagatc
aaacgtctgagcaggagattcaagcgtttggatttaaacaaagatggctctctctccctg
gacgagttcatgtcaataccagagctccagcagaatcctcttgtaaagagggtcattgat
attctggacactgatagaaacggtgccattgactttcaagagtttatagaaggcgtctcg
cagttcagtgtccaaggagaaacggacaagaagcttaaatttgctttcaagatatacgac
attgaccaggatggtttcatcagtaatggcgaactttttcaggttttaaagactatggtt
ggtagtaatctgacagataagcagctacaagaaattgttgataagactattttgtatgct
gacaaagacaacgatggaaagatatcttatgaagagttttgtgacgtggtaggcggttta
gatgttacatcaaaaatggttatagacttaaaataa

DBGET integrated database retrieval system