KEGG   Amphimedon queenslandica (sponge): 100640962Help
Entry
100640962         CDS       T02284                                 

Definition
calcineurin subunit B type 1-like
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100640962
Protein phosphatases and associated proteins [BR:aqu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     100640962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 171 aa AA seqDB search
MGVEQSLPLDLAKKFDPDEIKRLSRRFKRLDLNKDGSLSLDEFMSIPELQQNPLVKRVID
ILDTDRNGAIDFQEFIEGVSQFSVQGETDKKLKFAFKIYDIDQDGFISNGELFQVLKTMV
GSNLTDKQLQEIVDKTILYADKDNDGKISYEEFCDVVGGLDVTSKMVIDLK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgggagtagagcaatctttgccgcttgacctggccaagaaatttgatccggacgagatc
aaacgtctgagcaggagattcaagcgtttggatttaaacaaagatggctctctctccctg
gacgagttcatgtcaataccagagctccagcagaatcctcttgtaaagagggtcattgat
attctggacactgatagaaacggtgccattgactttcaagagtttatagaaggcgtctcg
cagttcagtgtccaaggagaaacggacaagaagcttaaatttgctttcaagatatacgac
attgaccaggatggtttcatcagtaatggcgaactttttcaggttttaaagactatggtt
ggtagtaatctgacagataagcagctacaagaaattgttgataagactattttgtatgct
gacaaagacaacgatggaaagatatcttatgaagagttttgtgacgtggtaggcggttta
gatgttacatcaaaaatggttatagacttaaaataa

DBGET integrated database retrieval system