KEGG   Amphimedon queenslandica (sponge): 100641378Help
Entry
100641378         CDS       T02284                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4-like
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100641378
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100641378
   04070 Phosphatidylinositol signaling system
    100641378
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100641378
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100641378
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 1253 aa AA seqDB search
MAGHIVVKRLEKQTPPERLLKGIDFWKWEEGDTIAHKMCFKVDSEGYFLSATGDDPSKSA
LVWDLVVVSDVRAGKVPKDGKLHDFLCTSLGISELSEDCCLCLVYKMDGITKLHFTYLMA
LDTESAQIFKTSINKLAHHLLDYQLSVHTYMRKHYVRMCLESNGHGQLPVKVVRKLMMVP
KTSKDILNYFESAKTNVKEKDDGTPYIDVSEFTEEIYMNLIDTLLQNRGPDLDVLKKECK
IKARKQYIDAKEFATVLNTQQRDPRLNDILHPRLTNEQAMALMDKYGGEKDRLTMKDLLQ
YLMSDDNMIIDPTVFDQCQDMWKPLNHYFINSSHNTYLNGHQVRSESLTEMYAQVLLTGC
RCVELDCWPRGDFEDIIITHGNTLCTKVPFKDVVETINEFAFAASEYPLILSIENHCNKY
PKLISRMADIFINVFGDKLLSAPFEDCPLEPGTPLPPVEKLKGKILIKDKVRAPKGGTGT
LSRGATIQDNSEDIPEPAASSPTSKEETVVTSPPPVTVVTDDTPSPTAAPPVIVEPPKSK
APLLTRPSLFKGMTILEDTDDGPIKQNSLEKSPSQASASSSEKSPPTTDEHKKTEGGGEG
GQQQESTAPADGNAEAKQPGSTPAKKDNGASDEASREEKKKYERGEALGASPLTELLNYV
TAMSFGSFEASEKLNCHYIMSSFGEEKGMNLIKTKPKEFVRYNIRQNSRVYPAGGSRMNS
SNYMPQIYWNVGCQMVALNFQTSDMPMQVNYAKFEMNGGTGYLLKPSVMCMDRGFNPFVQ
KKIDDTVPARLSVKIISGMFITSKKTELMVEIEMYGLPADIVRRRFTKKRAPAPHPFWDE
DYFVFKRVLLPELALLRLVVFDSDHVFMGQRVLPVNQLRAGFRHVSLRDKHNNPLGIANL
FLHIKIEDYVPDEYEDFVAALENPLMFATRALEQLAMGTDAEEDEFKDAAETEQSGESNI
RKGSAPEITPTINTPDGPIPEQKRKGSAAPPEIQVKSAQNFAKPRGSLVPTTGNDTLKKM
GTKSATMPSFQGETLSCLMEAKGREKLCAVSHDSPTIIENPDYLKLMKRFTKGNIDLANK
HEKATKKLQADQSKAMAKASKKGADQEKELEATHKAQLADLEKSQKEQIKALERQSKMEL
HEKQKFLLGVTHNAQRKALEKIKKIDLDKVTKEIIQELKLKKKDGDTKNKDWGRGVEQEV
FSTGMLTRSELSKVHDREKEYLEKTVVEAVKKMEEKHAEELAKLDEDENEIDL
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggctggccacattgtcgtgaagaggctcgagaagcagacgccgcctgagcgtttatta
aaaggcatagacttttggaaatgggaagaaggtgacaccatagctcataaaatgtgcttt
aaggttgattctgaaggatactttctttctgcaactggggatgatccctccaaaagtgcc
cttgtttgggatcttgttgttgtaagtgatgtcagagctggtaaagtacccaaggatggt
aaactacatgattttctgtgcactagtttgggtattagtgagttatctgaagattgctgt
ctgtgtttggtttacaaaatggacgggatcacaaaactccattttacctacctaatggca
ctagacacagagagtgctcagattttcaagacctccattaacaaactggcacaccatctt
cttgactatcaactctcagtacatacgtacatgagaaaacattatgttcgaatgtgtttg
gagagtaacggtcacggacagcttccagtcaaagtcgtccgaaagctcatgatggtacca
aagacctctaaagatatccttaactattttgagtcggcaaaaaccaacgtcaaggaaaag
gatgatggcacaccatacattgatgtgtcagaattcaccgaagaaatatacatgaaccta
atcgatactttattgcaaaatagaggacctgatctagacgtattgaagaaggaatgtaaa
ataaaagctaggaagcagtatattgatgccaaggagtttgctactgttttgaatacacaa
caacgtgatcctcgtcttaatgacatcttgcaccctcgactgactaacgaacaagctatg
gcactaatggataaatatggaggagagaaagatcggttaacaatgaaggatttacttcaa
tatctcatgagtgatgataatatgatcatcgacccaacagtattcgaccagtgccaggac
atgtggaaaccactcaatcactatttcatcaacagctctcacaacacttacctcaacggt
caccaggttcggtctgagtccctcactgagatgtatgctcaagtattgctcactggatgc
agatgtgtagaacttgattgctggcctcgtggtgatttcgaagacattattatcacacat
gggaacacactctgtactaaagtgccattcaaagacgtggtggagactattaatgagttt
gcatttgctgccagtgaataccctctcatcctctcaattgagaatcattgcaacaagtat
cctaaactcatcagcaggatggctgacatctttatcaatgtctttggagataagcttctc
tctgctccttttgaagattgccctctggagccaggcacaccactaccgccagtagagaaa
ctcaaagggaagatactaataaaggacaaggtcagggcaccaaagggagggactgggact
ctctcaagaggagcaacaatccaagataactctgaagacataccagaaccagctgcctca
tcaccaaccagtaaagaagagactgttgtgacttctcctcctcctgtcacagtggtgact
gatgatactccttctcctacagctgctcctcctgttattgtagaaccacctaagtccaag
gctccattgcttactagacctagtctattcaagggtatgactatacttgaagacacagac
gatggtccaatcaaacagaacagtttagagaaaagtccttctcaagcctcagcttcttct
agtgagaagagtccacctaccactgatgagcacaagaaaactgaaggaggaggagaaggt
ggacagcagcaagagtcaactgcaccagctgatggaaacgctgaagcaaaacaacctggg
agcactccagcaaagaaagataatggagctagcgatgaagcctcaagagaagagaaaaag
aaatacgagagaggagaagctcttggtgccagtcctttgacagagctactcaactatgtt
actgcaatgtcttttgggagctttgaagcatccgaaaagctcaattgtcattacattatg
tcctcctttggtgaagagaaaggtatgaatctcatcaagacgaagccaaaagagtttgtg
aggtataacataagacagaacagccgagtatacccagctggtggctccagaatgaactcc
agcaattacatgccacagatctattggaatgttggctgtcaaatggtagctcttaatttc
cagacatcagacatgccaatgcaagtcaactatgcaaaatttgaaatgaatggagggaca
gggtatttattaaagccaagtgtcatgtgcatggacagaggtttcaatccgtttgtgcag
aagaagattgacgacactgtccccgctcgtttatctgtcaagataatctcgggaatgttt
attacgtcaaagaagacggagctgatggttgagattgagatgtacgggctcccagctgac
attgtgagacgaagatttactaaaaaaagggcacctgctcctcatcctttctgggacgag
gactactttgtgtttaaaagagtattattgccagagctagctctactgcgtctagtagtg
tttgacagtgatcacgtgttcatgggccaaagagtcctaccagtcaatcagttaagggct
ggcttcagacatgtctcactgagggacaaacacaacaatcctctaggaatagccaacctc
ttccttcacattaagatcgaggactacgtacctgatgagtacgaagatttcgttgctgcc
cttgagaacccactgatgttcgccactagagctttggagcaactggcaatgggaactgat
gccgaggaagacgaatttaaagatgcagctgaaactgagcagtcaggggagtctaacatt
agaaaagggagtgcccctgagatcactcctactattaatacacccgatggtcctatacct
gagcagaaaagaaaaggatcggctgctcctccggaaattcaagttaaatctgctcaaaat
tttgcaaaaccaagaggctcacttgttcccacgactggtaatgataccctcaaaaagatg
ggcactaaatctgccactatgccctcattccaaggtgaaactctttcttgcctaatggaa
gcaaaaggaagggaaaaactttgtgcagtgtctcatgattcaccaaccattattgaaaat
ccagattatcttaaactgatgaaacgatttactaaaggaaatattgatttagccaataaa
cacgagaaggctactaagaaactgcaggctgatcagtccaaagcaatggccaaggcgtca
aaaaaaggagctgaccaagaaaaggagttggaggcgactcacaaagctcaattggctgat
ctggaaaagagtcagaaggagcaaataaaagcactagagagacaatcaaagatggagctt
catgaaaagcaaaagttcttgcttggagtgactcataatgcacagagaaaggctcttgag
aaaataaagaaaattgatctggataaagttacgaaagaaataattcaagagctgaaactt
aaaaagaaggacggagacactaaaaacaaggattggggaagaggtgttgaacaggaggtg
tttagcacaggaatgctgactcgttctgagctgagcaaagtccacgacagagagaaggaa
tatttggagaagacagttgtagaggctgtgaagaaaatggaggagaaacacgcagaggag
ttggcaaaattagatgaagatgaaaacgagatagatctttga

DBGET integrated database retrieval system