KEGG   Amphimedon queenslandica (sponge): 100641440Help
Entry
100641440         CDS       T02284                                 

Definition
AMSH-like protease-like
Orthology
K11866  
STAM-binding protein [EC:3.1.2.15]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100641440
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100641440
Peptidases [BR:aqu01002]
 Metallo Peptidases
  Family M67
   100641440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 430 aa AA seqDB search
AKSYFAEGELEQAFILYNKFATLFIEKLPKHHEYSRAPATEKQRVKKLVKSSFDQALLCK
ERLKEKYTQEKELFIQRRESERAIEERKPDPQLSEPRPQATEAPPTIQIEGEEGGVNDDD
DDEGCVSYDDMLLLSNNQPYYYDDDEEEMETGGGGIPTSTEGGKPTSTGGGVPTFIGGGK
PTSTGGWVPVDGGMRGDVPTSTGKEESDHVSLTATDAKLSKVLPSIVPQVIERSRSEQTQ
NCQAPPPTNYQAPPPTNYQAPPYQTPPTGYQAPPTNYQGAYQVPPPNQSKNTLKITHIIV
PKQMGKADSCETMKEEELFDALDKHDLITVGWIHTHPSQTAFMSSVDLHTHYSYQIMLQE
AIAIVVAPKYDKVGNFTLTQPHGLNYIGRCSGKGFHTHPKEPPLYEGCHGNLITPTLREI
PWAAVIGLVD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
gctaagtcttattttgcagaaggtgaattggaacaagcttttatactctacaacaagttt
gctactctattcattgagaaactcccaaagcatcatgagtactccagagctccagcaaca
gagaagcaaagagtaaagaaactagtgaaatcttcctttgatcaggcactcctctgtaag
gagagactaaaggagaagtatacacaagagaaggagctgttcatacagagaagagagagt
gaaagagctatagaagagaggaagccagacccacaattgtcagagccacgcccacaagca
accgaagccccacccaccatccaaatagaaggagaagaaggcggagtcaatgatgatgat
gatgatgaagggtgtgtctcttatgatgatatgctactattgtccaataaccaaccttat
tattatgatgatgatgaagaggaaatggaaacaggaggagggggaatacccacgtctact
gaagggggaaaacccacgtctactggagggggagtacccacgtttataggagggggaaaa
cccacgtctactggagggtgggttcctgttgatggagggatgagaggggatgtacccacg
tctaccggtaaagaggagtcagatcatgttagtttgactgctactgatgctaaacttagt
aaagtacttccttcaattgtacctcaggtcatagaacgaagccgatcagagcaaacacaa
aactgtcaagccccacccccaactaattatcaagctccgcctcctactaattatcaagct
cctccctaccagactccacctactgggtatcaagctccgcccactaattatcaaggtgca
tatcaggtcccaccccctaatcaatctaagaacacactcaagataacgcacatcatagtc
cctaagcaaatgggtaaggctgactcatgtgagactatgaaagaggaggaactctttgat
gctcttgacaaacacgacctcattactgtaggatggatacatactcatccttctcagact
gccttcatgtcaagtgttgatcttcacactcattattcttatcagattatgctacaagag
gccattgctatagttgttgcacccaaatatgacaaggttggtaatttcactctcactcaa
ccccacggtctcaattatatcggtagatgttccggtaaagggtttcacacgcacccaaaa
gaacctcccttgtatgagggttgtcatggaaacctcattactcccacattaagagaaatt
ccatgggcagcagtaattggattagttgattaa

DBGET integrated database retrieval system