KEGG   Amphimedon queenslandica (sponge): 100641440Help
Entry
100641440         CDS       T02284                                 

Definition
(RefSeq) STAM-binding protein-like A
  KO
K11866  
STAM-binding protein [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    100641440
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100641440
Peptidases [BR:aqu01002]
 Metallo Peptidases
  Family M67
   100641440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 476 aa AA seqDB search
AKSYFAEGELEQAFILYNKFATLFIEKLPKHHEYSRAPATEKQRVKKLVKSSFDQALLCK
ERLKEKYTQEKELFIQRRESERAIEERKATEEREQEEKKRREELEERARLEAYLAETPTQ
EKKLPLTTPTTPSKPDPQLSEPRPQATEAPPTIQIEGEEGGVNDDDDDEGCVSYDDMLLL
SNNQPYYYDDDEEEMETGGGGIPTSTEGGKPTSTGGGVPTFIGGGKPTSTGGWVPVDGGM
RGDVPTSTGKEESDHVSLTATDAKLSKVLPSIVPQVIERSRSEQTQNCQAPPPTNYQAPP
PTNYQAPPYQTPPTGYQAPPTNYQGAYQVPPPNQSKNTLKITHIIVPKQMGKADSCETMK
EEELFDALDKHDLITVGWIHTHPSQTAFMSSVDLHTHYSYQIMLQEAIAIVVAPKYDKVG
NFTLTQPHGLNYIGRCSGKGFHTHPKEPPLYEGCHGNLITPTLREIPWAAVIGLVD
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
gctaagtcttattttgcagaaggtgaattggaacaagcttttatactctacaacaagttt
gctactctattcattgagaaactcccaaagcatcatgagtactccagagctccagcaaca
gagaagcaaagagtaaagaaactagtgaaatcttcctttgatcaggcactcctctgtaag
gagagactaaaggagaagtatacacaagagaaggagctgttcatacagagaagagagagt
gaaagagctatagaagagaggaaggcaacagaagagagagaacaagaggagaagaaaaga
agagaagaactagaagagagagcaagactggaagcatatctagcagaaactcctactcaa
gagaaaaagcttcccttaaccacacctaccactccctccaagccagacccacaattgtca
gagccacgcccacaagcaaccgaagccccacccaccatccaaatagaaggagaagaaggc
ggagtcaatgatgatgatgatgatgaagggtgtgtctcttatgatgatatgctactattg
tccaataaccaaccttattattatgatgatgatgaagaggaaatggaaacaggaggaggg
ggaatacccacgtctactgaagggggaaaacccacgtctactggagggggagtacccacg
tttataggagggggaaaacccacgtctactggagggtgggttcctgttgatggagggatg
agaggggatgtacccacgtctaccggtaaagaggagtcagatcatgttagtttgactgct
actgatgctaaacttagtaaagtacttccttcaattgtacctcaggtcatagaacgaagc
cgatcagagcaaacacaaaactgtcaagccccacccccaactaattatcaagctccgcct
cctactaattatcaagctcctccctaccagactccacctactgggtatcaagctccgccc
actaattatcaaggtgcatatcaggtcccaccccctaatcaatctaagaacacactcaag
ataacgcacatcatagtccctaagcaaatgggtaaggctgactcatgtgagactatgaaa
gaggaggaactctttgatgctcttgacaaacacgacctcattactgtaggatggatacat
actcatccttctcagactgccttcatgtcaagtgttgatcttcacactcattattcttat
cagattatgctacaagaggccattgctatagttgttgcacccaaatatgacaaggttggt
aatttcactctcactcaaccccacggtctcaattatatcggtagatgttccggtaaaggg
tttcacacgcacccaaaagaacctcccttgtatgagggttgtcatggaaacctcattact
cccacattaagagaaattccatgggcagcagtaattggattagttgattaa

DBGET integrated database retrieval system