KEGG   Amphimedon queenslandica (sponge): 100641545Help
Entry
100641545         CDS       T02284                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     100641545
Peptidases [BR:aqu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   100641545
Exosome [BR:aqu04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   100641545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Peptidase_S9 Lipase_3 Chlorophyllase2
Motif
Other DBs
NCBI-GeneID: 100641545
NCBI-ProteinID: XP_003385124
UniProt: A0A1X7V962
Position
Unknown
AA seq 339 aa AA seqDB search
MMVRSRKKGSSSASSKHTEGDVSKDRPKQRRLCSFCLKFTVVLLLLYAFAALSFVKCTWI
QRELIYVNRLRIPFFSNLSDPSEFGLHHRTKHFFLTHQDSQCKIGVWYVPRVSTTEAPNS
LADGYPVVLYLHGNTGTRGTYPRIGVYKYLSEEKNCHVVTFDYQGFGDSDCYPNENNIME
DGLLVWKWIKEMAPNARVYLWGHSLGSGAATHLTLTLQSLGTAPYAVLLDAPFTNMVEAA
YNHPFGLPFKPLGEIFYSYMHENHSSIDRILHIECDIMIFHSHNDYIIPYHLGRKLYETA
VSKRNSKSGKVTFVNCGDQAHKYNYLSKELRKAVKTFIQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgatggtcagaagtagaaagaaagggtcttcttcagcaagttctaagcacacagaagga
gatgtgtctaaagataggcctaagcagaggaggctgtgctctttttgtcttaagtttact
gttgttctccttcttctttacgccttcgcggctctatccttcgtgaaatgtacctggata
cagagagagctgatttatgttaacaggctacgcatacctttcttttctaacctctctgat
ccttcagagtttggactccatcatcgaacgaagcacttctttctgacacaccaggatagt
cagtgtaagattggagtttggtatgttccacgtgtgagtactacagaggctcccaactcc
cttgctgatggatatccagttgtcttgtaccttcatggtaatacaggaacaagaggtaca
tatcctcgtattggagtgtacaagtacctgtcagaagagaaaaattgtcacgttgtaact
tttgattatcaaggcttcggtgattccgactgttatcctaatgagaataacataatggag
gatggtttattagtctggaagtggataaaggagatggctccaaatgcacgggtgtatttg
tggggtcattcgcttggttcgggtgctgcaactcatcttacgttgacgctacagtcgctt
ggcactgcaccatatgctgttttactggatgctccatttactaatatggttgaagcagca
tacaaccatccttttggtttgccatttaagccattaggagaaatattttacagctatatg
catgagaaccattcttcaattgatcgaatccttcatattgaatgtgacatcatgatattc
cacagtcataatgattatatcataccataccatttagggaggaagctgtatgagactgct
gtttctaagcgtaattctaaatctggcaaagtcactttcgttaattgtggtgatcaagcg
cacaagtataactatttgtcaaaagaattacgtaaagcagttaaaacgtttattcagtaa

DBGET integrated database retrieval system