KEGG   Amphimedon queenslandica (sponge): 100641589Help
Entry
100641589         CDS       T02284                                 

Definition
serine/threonine-protein kinase PRKX-like
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100641589
   04340 Hedgehog signaling pathway
    100641589
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100641589
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   100641589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 354 aa AA seqDB search
MACGGEMTDLTHEEEEEERMQHQTVLPAQTSTTTDSVAASELARHLGQVSLESSPILSGA
GSREARYTRKFSLRELEIQQTIGTGTFGRVVLTREISSRQYYALKIMAWTHHDNRFLYML
LEYVPGGELFTYLRTAQRFDNATSMFFASEIVLVMDYLHSQYIVYRDLKPENILIDSTGH
IKLCDFGFAKRLADRRTYTLCGTPEYLAPEIIQGKGHGREVDWWALGILVYEMLVGYPPF
FDEHPFRIYEKILEGKVDWPKVISSTAKDLIKKLLVKDVTRRLGSLKDGVDDVKQHKWFR
GVDWDAVLMRKSLPLIIPRVSHPGDTRNFERYPEDGWYNILPLRDEDIAPFKDF
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtgggggtgaaatgactgatctaacacacgaggaggaagaagaggagagaatg
cagcaccagacggttttacctgcccagaccagtaccacaactgacagcgtggcggcgagc
gaactagccagacacttgggacaagtctccctcgaatccagtcccattctcagcggagct
ggttccagagaggctagatatactaggaaattctctttgagagaattagaaatacaacaa
actataggtacaggtacatttggtcgtgtagtactaacaagagagatatcatcaaggcag
tattatgcactcaaaataatggcatggacgcatcatgataataggttcttatacatgtta
ttggagtacgtgcctggaggagagttgttcacttatctaagaactgctcagagatttgat
aacgccacgtcaatgttctttgcttcggagatagtgctggtaatggactacctccacagt
cagtatattgtgtatagagacctcaagcctgagaatatactcattgatagcaccggacac
attaagttgtgcgattttgggtttgctaagagactagctgataggcgtacctatacattg
tgtggtactcctgaatatttggccccagagatcattcagggcaaaggtcacggcagagaa
gttgattggtgggcactgggtatactagtctatgagatgctagttgggtacccgccattt
tttgatgagcatccgtttagaatatacgagaagatccttgaagggaaggtcgactggcct
aaagtgatcagtagcactgcaaaggacttgattaagaagttactggtgaaggacgtaacc
agaagactaggaagtcttaaggatggtgttgatgatgtcaagcagcacaagtggttccgt
ggcgttgattgggatgctgtcctcatgagaaaatcacttcctttgataataccaagggtt
tctcatcccggcgatacaaggaactttgaacgctatcctgaagacggttggtataacata
ttaccattaagagatgaggacattgcaccgtttaaagatttctag

DBGET integrated database retrieval system