KEGG   Amphimedon queenslandica (sponge): 100641589Help
Entry
100641589         CDS       T02284                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit PRKX-like
  KO
K19584  
protein kinase X [EC:2.7.11.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100641589
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: AGC group
  PRKX family
   100641589
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 386 aa AA seqDB search
MACGGEMTDLTHEEEEEERMQHQTVLPAQTSTTTDSVAASELARHLGQVSLESSPILSGA
GSREARYTRKFSLRELEIQQTIGTGTFGRVVLTREISSRQYYALKIMSIAEVIRLKQVEH
VNNEKEILTSLQHPFIVNLAWTHHDNRFLYMLLEYVPGGELFTYLRTAQRFDNATSMFFA
SEIVLVMDYLHSQYIVYRDLKPENILIDSTGHIKLCDFGFAKRLADRRTYTLCGTPEYLA
PEIIQGKGHGREVDWWALGILVYEMLVGYPPFFDEHPFRIYEKILEGKVDWPKVISSTAK
DLIKKLLVKDVTRRLGSLKDGVDDVKQHKWFRGVDWDAVLMRKSLPLIIPRVSHPGDTRN
FERYPEDGWYNILPLRDEDIAPFKDF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggcgtgtgggggtgaaatgactgatctaacacacgaggaggaagaagaggagagaatg
cagcaccagacggttttacctgcccagaccagtaccacaactgacagcgtggcggcgagc
gaactagccagacacttgggacaagtctccctcgaatccagtcccattctcagcggagct
ggttccagagaggctagatatactaggaaattctctttgagagaattagaaatacaacaa
actataggtacaggtacatttggtcgtgtagtactaacaagagagatatcatcaaggcag
tattatgcactcaaaataatgtcaatagcggaggtcatcagactaaagcaagtggagcat
gtgaacaatgagaaagagatactcacctcgctccagcatccattcatcgttaatttggca
tggacgcatcatgataataggttcttatacatgttattggagtacgtgcctggaggagag
ttgttcacttatctaagaactgctcagagatttgataacgccacgtcaatgttctttgct
tcggagatagtgctggtaatggactacctccacagtcagtatattgtgtatagagacctc
aagcctgagaatatactcattgatagcaccggacacattaagttgtgcgattttgggttt
gctaagagactagctgataggcgtacctatacattgtgtggtactcctgaatatttggcc
ccagagatcattcagggcaaaggtcacggcagagaagttgattggtgggcactgggtata
ctagtctatgagatgctagttgggtacccgccattttttgatgagcatccgtttagaata
tacgagaagatccttgaagggaaggtcgactggcctaaagtgatcagtagcactgcaaag
gacttgattaagaagttactggtgaaggacgtaaccagaagactaggaagtcttaaggat
ggtgttgatgatgtcaagcagcacaagtggttccgtggcgttgattgggatgctgtcctc
atgagaaaatcacttcctttgataataccaagggtttctcatcccggcgatacaaggaac
tttgaacgctatcctgaagacggttggtataacatattaccattaagagatgaggacatt
gcaccgtttaaagatttctag

DBGET integrated database retrieval system