KEGG   Amphimedon queenslandica (sponge): 100641617Help
Entry
100641617         CDS       T02284                                 

Definition
glutathione S-transferase omega-1-like
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:aqu00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:aqu00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:aqu00982]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 252 aa AA seqDB search
MSLIRTRPEEKGADIPLRIYSNPICPYAQRARLIAAFKGVKHEIINVHLKEKPQWYLDDI
NPYGLVPTIEHNGHLIRESLVTFEYIDEVFGDSHSWPTDPYKKAQAKLLLSDFGDRFTPN
YYKYYRNAQDENTPKLLQKYFKSVEELIAQNGGPFIFGKNVSAIDLLIWPWFERLPALFT
HAPELKTLYSVDSVPLLIKWDAAMRETDAVKSTITPAERMTAFLANALSNGGKHDYSLLN
IDGLKIYTKETE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtctttaataaggaccagaccagaagagaaaggagctgatattcctctaaggatatac
agcaatcctatttgcccctatgctcagagggccagactcattgccgcattcaaaggtgtt
aaacatgagatcattaacgttcatttgaaggagaagccccagtggtatcttgatgacatt
aatccttatggtcttgtaccaacgattgagcacaatggacatctcatccgtgaatcattg
gtgacctttgaatacattgatgaagtttttggtgatagtcactcgtggccaactgatcca
tataaaaaagcacaagctaaactattgctaagcgattttggtgatagattcactcctaat
tattataagtattatcgtaatgctcaagatgaaaacactcccaagctcctacagaagtac
ttcaaatcagttgaggagctaattgctcaaaatggtggcccgttcatatttggcaaaaac
gtctcagctattgatttgctgatatggccttggtttgagagactacctgctctatttaca
catgcaccagaattaaagacactgtacagtgtagatagtgtgccactactcattaagtgg
gatgctgcaatgagagagactgatgcagtcaagagtactatcactccagctgagcgtatg
actgcatttcttgctaatgccctcagcaatggagggaagcatgattacagtctattgaat
attgacggtttgaaaatatacaccaaagaaacagagtaa

DBGET integrated database retrieval system