KEGG   Amphimedon queenslandica (sponge): 100641640Help
Entry
100641640         CDS       T02284                                 

Definition
putative serine/threonine-protein kinase C05D10.2-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100641640
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100641640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 581 aa AA seqDB search
MTAEIDRHILVKYDIKRRIGKGAYGIVWKSVDRRTGEIVALKKIFDAFANSTDAQRTFRE
ILFLQAFSNHPNVIQLINVIRSSTDKDIYLVFEFMDTDLHAVIKSKILQSVHMQYIMSQL
CRVLKYIHSGNVIHRDLKPSNILINSECFIKLADFGLARSLASISNEGSKGAGGDGVSDF
NPAMTDYVATRWYRSPEILLGSRRYTRGVDMWSLGCILAEMIASKPLYPGSSTINQLDRI
MSTLPPPSRQDVESIKSPYAKAILDQIIHKRHKYLTDILPQADDISLDLLNKLLNFNPNK
RLTAENCLEHPYLSKFHDSDKEPVIGCQIVPVIDDNVQLTAHEYREQLYKDIVLRHTELH
PQSPKPASPAPPSNPDVLVEDCELESCISDHSLAQSERGKKEKKLKEVGGVGGGGGYVSH
SSPSLPAKKTSDDSEGGGGAEVKSRAFIPFMNRSKSAAVQARGGIMPRPSTPLQAHSRTT
VQPLSRARIGCASASHITTKKPVPPPPPPPPHSTHGKPIDLTVTSARIVPISRPPPPSHQ
WKEVNRRVSRGGPSRYASGTYTQTHGVIRRSDLMTIKQNNW
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgactgcagagattgacagacacattctggtcaagtatgacataaaaagaagaatagga
aaaggagcttatggcatagtgtggaaaagtgttgataggagaactggagaaattgtagca
ctaaagaagatatttgatgcttttgcaaactcaactgatgcacagaggacatttcgggag
atattgttcctccaagctttctctaaccatccaaatgtgatccagcttatcaatgtaata
aggtcgtcaaccgacaaggacatttacttagtatttgaatttatggatactgatcttcat
gcggtgataaagagtaagatactccagtcagttcacatgcagtacatcatgagtcagttg
tgtcgggtattgaaatacattcattccggtaacgtcattcatcgtgacctgaaacccagt
aatatcctcattaattctgaatgttttattaagttggctgattttggattagctcgatca
ctggctagcataagcaatgaagggagtaaaggggctggaggtgatggtgttagtgatttc
aatccagccatgactgattatgttgctactcgttggtatcgtagtccagagatattgcta
ggatcaagacgttatactagaggtgtggatatgtggtctcttggctgtatattagcagaa
atgatagcaagtaagccactctaccctggctcatccaccatcaaccagttggacaggata
atgtctaccctccctcctccctcaagacaagacgtggagagcattaaatcaccttacgcc
aaagcaatactggaccaaataatacacaagagacacaagtatttgactgatatattacct
caagctgatgatatttcacttgatttactcaacaagttgctaaatttcaatccgaacaag
agactgactgctgaaaattgtctagagcatccttacctatcaaagtttcatgattctgac
aaggagccagtgattgggtgtcaaatagtgccagtgattgatgataatgtacaactaaca
gctcacgaatatagagaacaactatacaaggatatagtattgagacacactgagcttcac
ccacaatcacctaaaccagcctcaccagcccctccttcaaaccctgatgtattggttgag
gactgtgaactggagagctgtatatcggaccacagtctagcacaatcagagagaggaaag
aaagaaaagaagttaaaagaagtaggaggagtaggaggaggaggagggtatgtgtctcat
tcttctccttctctgcctgctaagaagacaagtgatgattctgaaggaggaggaggagct
gaagtgaagtcaagggcttttatacctttcatgaatcgaagtaaatcagcagcagtacag
gcaagaggagggataatgcctcgtcccagtactcctcttcaagctcactccaggactaca
gtacagccattatcacgagctaggatagggtgtgcctcagctagtcacataacaacaaag
aaaccagttcctcctcctcctccccctccccctcactctacccacgggaaaccaatagac
ctcaccgtcaccagtgctagaattgtcccaatatctcgcccacctccccccagtcatcaa
tggaaggaagtgaatagaagagtatcaagaggaggcccctcacgctatgcatcagggacc
tacacacagactcatggagttatacgtagatcagatttaatgacaataaaacaaaacaac
tggtga

DBGET integrated database retrieval system