KEGG   Amphimedon queenslandica (sponge): 100641670Help
Entry
100641670         CDS       T02284                                 

Definition
(RefSeq) NADH-cytochrome b5 reductase 3-like
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
aqu00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100641670
Enzymes [BR:aqu01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     100641670
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 100641670
NCBI-ProteinID: XP_003384892
UniProt: A0A1X7VC46
Position
Unknown
AA seq 326 aa AA seqDB search
MLPIGFGLLYLINSKGAIMEVPSTQILIIGGAIAVGLALIIYKTLSGSSSTRSGPPPEAP
LKGPVALDSENKIPFKLISKQIITHDTRKFRFALQSDKHVLGLPIGNHMYLSARINGELV
VRPYTPVTSNDELGHFDLIIKVYKAGVHPRFPDGGKMSQYLDSLEIGDTVDVRGPEGKVS
YAGRGYFKVRKTNDFCYAKNVGLIAGGTGITPMLQIIKAILKDPEDKTKVSLLFANQTQD
DILVRSELEWLAKQHKNFTLWYTLDKSPDGWPYSTGFINDEMISRHLPPPNKDTLILMCG
PPPMIKFACLPNLEKLKYTEKMYIAF
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgctgccaattgggtttggcctcctttatctcattaacagcaaaggagcgatcatggag
gtcccgtctactcaaattcttataattggaggtgccattgctgttggtcttgctcttatt
atatataaaactctaagtgggtcgtcttcaactagatcaggtccaccaccagaggctcct
ctcaagggccccgtggctctggactccgagaacaagattccattcaaactgatcagcaaa
cagataatcactcatgatacaaggaagttccgttttgctttgcagtcagataaacatgtt
ctaggactccctattggtaaccacatgtatctcagtgcccgtatcaatggtgagcttgta
gtacgtccttatacacctgtcacctctaatgacgaactgggacactttgacctcattatt
aaggtatacaaggctggggttcacccacgctttcctgatgggggcaagatgtcgcaatat
ttggattcgctggaaataggtgacaccgttgacgtgaggggaccagagggaaaggtatcc
tatgctggaagaggttacttcaaagtgcgcaagactaatgatttctgttatgctaaaaac
gtaggactaattgctggaggaactggtattacgccaatgctgcagattatcaaggccata
ctaaaggatcctgaagataagactaaagtctccctcctctttgctaatcaaacacaagat
gacatccttgtacgctctgaactggaatggcttgcaaagcaacacaagaacttcacactg
tggtacacgttagacaaatcaccagatggttggccgtacagcactggtttcattaatgat
gaaatgatatctcgtcacttgcctccaccaaataaagacacattgatcttgatgtgtggg
ccaccgcctatgatcaagtttgcttgtcttcctaatttggaaaaacttaaatacacagag
aaaatgtacattgcattttag

DBGET integrated database retrieval system