KEGG   Amphimedon queenslandica (sponge): 100641751Help
Entry
100641751         CDS       T02284                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100641751
Transfer RNA biogenesis [BR:aqu03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100641751
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 551 aa AA seqDB search
MGKNKGKKAPQVSKAERMVMTVSEIVRTLIEAHEKGEDVNLNRLKGEVASKNGLSTQPRL
VDIIAAVPPDYRKALLPKLKAKPIRTASGIAVVAVMCKPHRCPHITFTGNICVYCPGGPD
SDFEYSTQSYTGYEPTSMRAIRARYNPYLQSKHRLAQLKQLGHSIDKVEYIVMGGTFMAL
DDAYKDFFIRNLHDALSGHTSNSVEEAVKYSERSIVKCIGITIETRPDYCLRKHLSQMLS
YGCTRLEIGVQSVYEDVARDTNRGHTVNAVCESFVAAKDAGFKVVAHMMPDLPNVGLERD
IEQFIEFFENPAFRADGLKIYPTLVIRGTGLYELWKTGRYKSYPPSVLVDLVARILSLVP
PWTRVYRVQRDIPMPLVTSGVEHGNLRELALARMNDLGTKCRDVRTREVGIQEIHHKVSP
YEVELIRRDYVANGGWETFLSYEDPKQDILIGLLRLRKCSEETYRPELVGGVSIVRELHV
YGSVVPVSSRDPGKFQHQGFGMLLMEEAERIALEEHGSNKIAVISGVGTRNYYRKIGYEL
EGPYMTKSLLL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaaataaaggaaagaaagctcctcaagtttcaaaagcagaacgaatggtaatg
accgtttctgagattgtccgtactctaattgaagcacacgaaaaaggagaagacgttaat
ttaaacagattaaaaggagaggtggctagtaagaatggtctctctactcaacctcgtctt
gttgatataatagcagctgtgcctcccgactatcgtaaagctttgttacccaaattaaag
gctaaacctattcgtacagcatcgggtattgcggttgttgccgtcatgtgtaagccacac
aggtgccctcacatcaccttcactggtaacatctgcgtttattgtcctggaggtccagat
tcagattttgaatattctacacagtcttatacaggatatgagccaacatcaatgagagct
ataagagcaaggtataatccttaccttcagtcaaagcacagactagctcagttgaagcag
ctgggtcattccattgataaggtagagtacatcgtgatgggcggcaccttcatggcactg
gacgacgcctacaaagacttcttcattcgtaatcttcacgacgcactttctggtcacaca
agcaactctgttgaagaagctgtcaaatattctgagaggagtattgtaaaatgcattggc
attacaatagagacaaggccggactactgcctcagaaagcacttgagtcagatgctctcc
tatggctgtactagattagaaatcggagtgcagagtgtctatgaggatgtagccagagac
acaaacagaggtcacactgtgaatgcagtatgtgagtccttcgtggcagccaaggatgct
ggttttaaagtagtggcccacatgatgcctgacctacctaatgttggactggagagagat
atagagcaattcattgaattttttgagaaccctgctttcagagcagacggactcaaaatc
tacccaaccctcgtaataagaggaactggactatacgaactatggaaaacaggtcgatac
aagagttacccaccatcagtccttgttgatttagtggctcggatactctccctcgttcct
ccatggactcgagtatatcgggtacaaagggatataccaatgccactggtaacctcaggg
gtggagcatggtaacttgagggagctagcattagctaggatgaacgatcttgggactaaa
tgtcgtgatgttaggactagggaggttgggatacaagagattcatcacaaggtcagtcct
tacgaggttgagctgattcgaagagactacgtcgctaatggaggctgggaaacgttccta
tcttatgaagatcctaagcaagatattcttattgggctccttcgcctcagaaaatgttca
gaagaaacctaccgaccagaattggtcggaggtgtctccattgtacgagaattacatgtc
tatggcagtgttgttccagttagttcgagagatccaggaaaattccagcaccagggattc
gggatgttactgatggaagaagcggaaaggatcgcattggaagagcatggctctaacaag
attgctgtcatttctggtgtcggtacacggaattattatcgcaagattggctacgaacta
gaaggcccatacatgacaaagagtttattgttatga

DBGET integrated database retrieval system