KEGG   Amphimedon queenslandica (sponge): 100642017Help
Entry
100642017         CDS       T02284                                 

Gene name
Pnpla6
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100642017 (Pnpla6)
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100642017 (Pnpla6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 1191 aa AA seqDB search
MASETVSPHSVSPSLSPSVSVDPMINSSVALMYNLWMDWGIKQKSKVVPSSRSSEIRKRD
LVRHLGRRVMRVGKTRLHEFRRNSIGFRFQPLPPSTSDIQLHREPPAAYLEADLELESQI
PHDVMYLLKSVRVFGHFEKPLFMELCKHVETKFVPSGAILFRPGQVDDSIYVVQNGKLHV
FLIEQDGTEFPLKDAGTGESVHSLLSLMDAIIGQPHPFRTVSARAVRDTYVLQIRANSFK
KFFDENPDSLLRIIQIIMLRLQRVTFLALNQFLGLGQELLIQKVSIPTDLNIYKLKHSFQ
RTGTNQSLQVDDYETSDTINSFSTQLVGGDSDSEGLTSDGRNSDPPPPPLEVTKYDSTGD
ESTGKKPKAVAIDTSQNASFTHRLIPAQSPEFDNVINQARVDRMEFGGSQPVKANLIQNV
PLRYSHFVSLESNDILQAATADLIKIFQLKDNSLLNGRIQLIEVACNSVLGYEGDLDSCV
YFIVSGRIKVFKLHSSKESGSCSHEELLYYAQPGEFVGVLSALTGEPSFISLKAASYSHL
IAITKTNLYQILSEHPIAVCGIASDLVRRLSHFVKQMDFALDWMDLEAGKALYRQGEEST
VAYIILNGRLRSVVKNEDGKKELADEYGRGETVGVVEVMTKSPRATTVHAIRDTELASVP
LGLLNTIKMKKPQVVSRLIQLLGEKIMGSYNRVLSMPAGPTENSTMLSKHLVSNLSTVAV
VPISADIPLSHITRHLTAAVNTIVSAKRLTSKLIEEELGTSALESVHEYRLCTWLGHQED
THKIVIYQANGSLTPWTARCIRQADCILLVGVGDQVPNFNSMGTIVTQVEKISARVRKEL
VLLHKEGVAHPQGTVQWLNALGWLSSYFHVRCPDEFFTETSSAADERSLPTPPDKHSDIA
RLARRLTGTSVGLVLGGGGARGLSHCGIIKAFQEAGVPIDMVGGTSIGALVGALYSEECD
AGEVLKRASTFSKRMAAYWDKILDLTYPSMSMFTGRAFNTIIYNVFHERHIEDLWLPYYC
VTTDVTDSKMRVHTAGCLWRYVRASMSLSGYLPPLCDPVDGHLLLDGGYVNNLPADLMSS
QGAEHIIAIDVGSEDNNALLNYGDSISGWRIICNKLNPFSKTMRIPNLTEIQSRLAYVSC
VRQLETVKNDSSCEYIRPPIDNIATMQFGSFDEIAHIGYKHCKSVLNKNET
NT seq 3576 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgaaacagtatctccgcattctgtctctccctctctctctccctcagtttct
gttgatccaatgatcaatagcagtgtcgctctaatgtataacctttggatggactggggg
atcaaacagaagtctaaagtggtaccgtcttctcgctcatcagagataaggaaacgggat
ttagtccgtcacttgggacgaagagtcatgagagttggaaagactcgtcttcatgaattt
agaagaaattcaattgggtttcggttccagcccctcccccccagtacgtctgatattcag
ttacacagagaaccacctgcagcttaccttgaagcagatctggagcttgagagtcaaata
cctcatgatgttatgtatcttttaaaaagtgttcgggtttttggtcattttgagaaacct
ttgttcatggaactgtgcaaacacgtggagacaaagtttgttccatctggtgccattttg
tttcgaccaggccaggtggatgacagtatctatgtagtacagaatggtaaactgcatgtg
ttcttgattgaacaagatggaactgagtttcctcttaaagatgctggaactggggaaagt
gttcacagtttactgagcctaatggatgccattattggtcagccacacccctttaggact
gtctctgctagagcagtgagagatacttacgtacttcagataagagctaattcatttaaa
aagttttttgatgaaaatccggattcacttctaagaataatacaaatcataatgctgcgg
ttgcagagggtcaccttccttgcattgaaccagtttcttggactaggacaagaactactg
atacaaaaagtgtctatacctactgacctcaatatttataaactgaagcactcctttcaa
agaactggaactaaccaatcgcttcaagttgatgattatgaaaccagtgatactattaat
agtttcagtactcaattggtgggcggtgacagtgacagtgagggattgacatcagatgga
aggaatagtgaccctccccctcctcctcttgaagtgactaagtatgactcgactggtgat
gaatccactggcaagaagccaaaggctgttgctatagataccagtcaaaatgcatcattc
actcaccgactgataccagcccagagtcctgagttcgataatgtcattaatcaggctaga
gttgatagaatggagtttggtggttctcagccagtgaaagctaatctcattcaaaatgtt
ccattaagatattctcactttgtgtctctcgagagcaacgatatattacaagcagcaact
gctgacctcatcaaaatattccaactcaaagataactcacttctcaatggaaggatacag
ctaattgaagtggcttgtaactctgtccttggatatgaaggagatcttgacagttgtgtg
tatttcatagtctctgggcggattaaagtgttcaagttgcacagttcaaaggagagtggc
tcatgcagtcatgaagagttgctgtattacgctcaacctggagaatttgttggagtcctg
tcagctctgactggtgaaccttcctttatatcattgaaagcagcttcatattctcatctt
attgccatcactaagactaacctttatcagatcctgtcagagcacccgatagctgtctgt
gggatagcgtctgatcttgtgagaagattgtctcattttgtcaaacaaatggactttgct
cttgactggatggacttagaagctgggaaagcattgtacaggcagggggaggagtctact
gttgcttatatcatactgaacgggaggttgcggtcagtggtgaagaatgaagacggaaag
aaagaattagctgatgagtatgggcgtggtgaaacagtgggtgtggttgaagtaatgaca
aaatcacctcgtgccactacagtccatgctataagagatacagagttagcaagtgttcca
ttgggtttgctaaatacaattaaaatgaagaaacctcaggtggtgtccaggctgatccag
ttactaggggagaagataatgggaagctataacagagtcctgtcaatgccagctggaccc
actgagaactctacaatgctcagtaagcacttggtctctaacctctcgactgttgctgtg
gtaccaatatcagctgacattcccttatcacacatcaccagacacctcactgctgctgtc
aacactattgtttctgctaaaaggttaaccagtaaactgatagaagaagaactgggtaca
tcagcactagagagtgttcatgagtacagactgtgcacgtggctagggcatcaggaagac
actcataaaattgttatttatcaagcaaacggatccttaaccccttggactgctagatgc
atcagacaagctgactgtatcttactggtgggggtaggggaccaagtacctaactttaat
tcaatgggaacgatagttacacaagttgaaaagatatcagcaagagttcgtaaagagctg
gtcctgcttcataaagaaggtgtggctcacccacagggcacagtccagtggctcaatgct
ttgggttggctgtcatcatatttccatgtgaggtgccctgatgagttcttcacagaaacc
tcctcagcagctgatgaaagatcactacccaccccaccagacaaacattctgacattgca
agattggcaaggaggctaacagggacatcagttggactggtattaggaggaggaggagct
agggggttgtctcactgtgggatcatcaaagcatttcaagaagcaggtgttcctattgat
atggtgggtggtaccagcattggtgctctagttggggccctctactctgaggaatgtgac
gctggagaagttcttaaaagagcaagcaccttctccaagagaatggcagcatactgggac
aagatactggacctgacctatccttcaatgtcaatgtttactgggcgtgcatttaatact
ataatatacaatgtatttcatgagagacacattgaggacttatggctgccgtactattgt
gtaactactgatgtcactgactccaagatgagggtccacactgctggctgcttgtggagg
tacgtgagagctagcatgtcactgtctgggtacctccctcctctttgtgaccctgtggat
ggacacctcctccttgacggaggatatgtcaacaacctacctgctgatctgatgtcgtct
caaggagctgaacacatcattgccattgacgttggatcggaagataataacgccctattg
aattatggggactctatctctggctggagaattatttgtaataaattgaatcctttttca
aaaacaatgaggattcctaacttgacagagatacagtcaagattggcgtatgtatcttgt
gttcgacaattggaaactgtcaagaatgattcttcttgtgaatacatacgaccacctatt
gacaatattgctacaatgcagtttggaagttttgatgaaattgcacacattggttataag
cactgcaagtcagtcctcaacaaaaacgaaacctaa

DBGET integrated database retrieval system