KEGG   Amphimedon queenslandica (sponge): 100642017Help
Entry
100642017         CDS       T02284                                 

Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7 isoform X1
  KO
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100642017
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100642017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 1380 aa AA seqDB search
MASETVSPHSVSPSLSPSVSVDPMINSSVALMYNLWMDWGIKQSQELSLLLYNNQLASVT
SVLILLLSCAFVYCCNCCCCCCYRRQQERRQSKVVPSSRSSEIRKRDLVRHLGRRVMRVG
KTRLHEFRRNSIGFRFQPLPPSTSDIQLHREPPAAYLEADLELESQIPHDVMYLLKSVRV
FGHFEKPLFMELCKHVETKFVPSGAILFRPGQVDDSIYVVQNGKLHVFLIEQDGTEFPLK
DAGTGESVHSLLSLMDAIIGQPHPFRTVSARAVRDTYVLQIRANSFKKFFDENPDSLLRI
IQIIMLRLQRVTFLALNQFLGLGQELLIQKVSIPTDLNIYKLKHSFQRTGTNQSLQVDDY
ETSDTINSFSTQLVGGDSDSEGLTSDGRNSDPPPPPLEVTKYDSTGDESTGKKPKAVAID
TSQNASFTHRLIPAQSPEFDNVINQARVDRMEFGGSQPVKANLIQNVPLRYSHFVSLESN
DILQAATADLIKIFQLKDNSLLNGRIQLIEVACNSVLGYEGDLDSCVYFIVSGRIKVFKL
HSSKESGSCSHEELLYYAQPGEFVGVLSALTGEPSFISLKAASYSHLIAITKTNLYQILS
EHPIAVCGIASDLVRRLSHFVKQMDFALDWMDLEAGKALYRQGEESTVAYIILNGRLRSV
VKNEDGKKELADEYGRGETVGVVEVMTKSPRATTVHAIRDTELASVPLGLLNTIKMKKPQ
VVSRLIQLLGEKIMGSYNRVLSMPAGPTESKSTVELIIMYINMYSLDSTMLSKHLVSNLS
TVAVVPISADIPLSHITRHLTAAVNTIVSAKRLTSKLIEEELGTSALESVHEYRLCTWLG
HQEDTHKIVIYQANGSLTPWTARCIRQADCILLVGVGDQVPNFNSMGTIVTQVEKISARV
RKELVLLHKEGVAHPQGTVQWLNALGWLSSYFHVRCPDEFFTETSSAADERSLPTPPDKH
SDIARLARRLTGTSVGLVLGGGGARGLSHCGIIKAFQEAGVPIDMVGGTSIGALVGALYS
EECDAGEVLKRASTFSKRMAAYWDKILDLTYPSMSMFTGRAFNTIIYNVFHERHIEDLWL
PYYCVTTDVTDSKMRVHTAGCLWRYVRASMSLSGYLPPLCDPVDGHLLLDGGYVNNLPAD
LMSSQGAEHIIAIDVGSEDNNALLNYGDSISGWRIICNKLNPFSKTMRIPNLTEIQSRLA
YVSCVRQLETVKNDSSCEYIRPPIDNIATMQFGSFDEIAHIGYKHCKSVLSSWTKSHTLS
HLLTETLAKDFRQKRNLMEPSDKSLSRKVPSIHNLAALAAEIPQLKNKETVMQDEDIDGY
WSNPEVVPVSTEEPDEEEEDSYEEQSLKKGTDTKNNRQQLVTNNSNRSMAYSDSEIHNIN
NT seq 4143 nt NT seq  +upstreamnt  +downstreamnt
atggcgtctgaaacagtatctccgcattctgtctctccctctctctctccctcagtttct
gttgatccaatgatcaatagcagtgtcgctctaatgtataacctttggatggactggggg
atcaaacagagtcaggagttatcattactactgtataacaaccaactggccagtgtcacc
tcagtgttgatattactactgagctgtgccttcgtgtactgctgcaactgctgctgctgc
tgctgctataggagacagcaagagagacgtcagtctaaagtggtaccgtcttctcgctca
tcagagataaggaaacgggatttagtccgtcacttgggacgaagagtcatgagagttgga
aagactcgtcttcatgaatttagaagaaattcaattgggtttcggttccagcccctcccc
cccagtacgtctgatattcagttacacagagaaccacctgcagcttaccttgaagcagat
ctggagcttgagagtcaaatacctcatgatgttatgtatcttttaaaaagtgttcgggtt
tttggtcattttgagaaacctttgttcatggaactgtgcaaacacgtggagacaaagttt
gttccatctggtgccattttgtttcgaccaggccaggtggatgacagtatctatgtagta
cagaatggtaaactgcatgtgttcttgattgaacaagatggaactgagtttcctcttaaa
gatgctggaactggggaaagtgttcacagtttactgagcctaatggatgccattattggt
cagccacacccctttaggactgtctctgctagagcagtgagagatacttacgtacttcag
ataagagctaattcatttaaaaagttttttgatgaaaatccggattcacttctaagaata
atacaaatcataatgctgcggttgcagagggtcaccttccttgcattgaaccagtttctt
ggactaggacaagaactactgatacaaaaagtgtctatacctactgacctcaatatttat
aaactgaagcactcctttcaaagaactggaactaaccaatcgcttcaagttgatgattat
gaaaccagtgatactattaatagtttcagtactcaattggtgggcggtgacagtgacagt
gagggattgacatcagatggaaggaatagtgaccctccccctcctcctcttgaagtgact
aagtatgactcgactggtgatgaatccactggcaagaagccaaaggctgttgctatagat
accagtcaaaatgcatcattcactcaccgactgataccagcccagagtcctgagttcgat
aatgtcattaatcaggctagagttgatagaatggagtttggtggttctcagccagtgaaa
gctaatctcattcaaaatgttccattaagatattctcactttgtgtctctcgagagcaac
gatatattacaagcagcaactgctgacctcatcaaaatattccaactcaaagataactca
cttctcaatggaaggatacagctaattgaagtggcttgtaactctgtccttggatatgaa
ggagatcttgacagttgtgtgtatttcatagtctctgggcggattaaagtgttcaagttg
cacagttcaaaggagagtggctcatgcagtcatgaagagttgctgtattacgctcaacct
ggagaatttgttggagtcctgtcagctctgactggtgaaccttcctttatatcattgaaa
gcagcttcatattctcatcttattgccatcactaagactaacctttatcagatcctgtca
gagcacccgatagctgtctgtgggatagcgtctgatcttgtgagaagattgtctcatttt
gtcaaacaaatggactttgctcttgactggatggacttagaagctgggaaagcattgtac
aggcagggggaggagtctactgttgcttatatcatactgaacgggaggttgcggtcagtg
gtgaagaatgaagacggaaagaaagaattagctgatgagtatgggcgtggtgaaacagtg
ggtgtggttgaagtaatgacaaaatcacctcgtgccactacagtccatgctataagagat
acagagttagcaagtgttccattgggtttgctaaatacaattaaaatgaagaaacctcag
gtggtgtccaggctgatccagttactaggggagaagataatgggaagctataacagagtc
ctgtcaatgccagctggacccactgagagtaagtcaactgttgaactgattataatgtac
atcaacatgtattcattagactctacaatgctcagtaagcacttggtctctaacctctcg
actgttgctgtggtaccaatatcagctgacattcccttatcacacatcaccagacacctc
actgctgctgtcaacactattgtttctgctaaaaggttaaccagtaaactgatagaagaa
gaactgggtacatcagcactagagagtgttcatgagtacagactgtgcacgtggctaggg
catcaggaagacactcataaaattgttatttatcaagcaaacggatccttaaccccttgg
actgctagatgcatcagacaagctgactgtatcttactggtgggggtaggggaccaagta
cctaactttaattcaatgggaacgatagttacacaagttgaaaagatatcagcaagagtt
cgtaaagagctggtcctgcttcataaagaaggtgtggctcacccacagggcacagtccag
tggctcaatgctttgggttggctgtcatcatatttccatgtgaggtgccctgatgagttc
ttcacagaaacctcctcagcagctgatgaaagatcactacccaccccaccagacaaacat
tctgacattgcaagattggcaaggaggctaacagggacatcagttggactggtattagga
ggaggaggagctagggggttgtctcactgtgggatcatcaaagcatttcaagaagcaggt
gttcctattgatatggtgggtggtaccagcattggtgctctagttggggccctctactct
gaggaatgtgacgctggagaagttcttaaaagagcaagcaccttctccaagagaatggca
gcatactgggacaagatactggacctgacctatccttcaatgtcaatgtttactgggcgt
gcatttaatactataatatacaatgtatttcatgagagacacattgaggacttatggctg
ccgtactattgtgtaactactgatgtcactgactccaagatgagggtccacactgctggc
tgcttgtggaggtacgtgagagctagcatgtcactgtctgggtacctccctcctctttgt
gaccctgtggatggacacctcctccttgacggaggatatgtcaacaacctacctgctgat
ctgatgtcgtctcaaggagctgaacacatcattgccattgacgttggatcggaagataat
aacgccctattgaattatggggactctatctctggctggagaattatttgtaataaattg
aatcctttttcaaaaacaatgaggattcctaacttgacagagatacagtcaagattggcg
tatgtatcttgtgttcgacaattggaaactgtcaagaatgattcttcttgtgaatacata
cgaccacctattgacaatattgctacaatgcagtttggaagttttgatgaaattgcacac
attggttataagcactgcaagtcagtcctcagtagttggactaaaagccacaccctctca
cacttattaactgagactctcgctaaggattttagacaaaaacgaaacctaatggaacca
tcagataagtcgttaagtcgtaaggttccatcaattcataacctggcagctctagcagct
gaaatacctcaactgaagaacaaggagacggtgatgcaagatgaagacattgatggttat
tggtctaatcctgaggtagtccctgtgagtactgaggaaccggacgaggaggaggaggac
agctatgaagaacagtcactgaagaaaggcactgatactaaaaataacagacagcaactt
gttactaataatagtaacagaagtatggcatattctgactctgagatccataatataaat
taa

DBGET integrated database retrieval system