KEGG   Amphimedon queenslandica (sponge): 100642019Help
Entry
100642019         CDS       T02284                                 

Definition
ubiquitin carboxyl-terminal hydrolase 14-like
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100642019
Peptidases [BR:aqu01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100642019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 483 aa AA seqDB search
MPTFAVKVKWGKVKYDDLELNTDEPPVIFKSQLFSLTGVPLERQRLMIAGQSIGDDTWTD
PVIKKIKPNCMFMLMGSADALPTAPKEKTIFIEDMTEADAARLLEVPFGLHNLGNTCYMN
ASLQCIRAIPELRREILDFTGHHGLVEGLDVASHELTARMNELFVSMEKREPQLELALFL
QGLQTVVPHFATKDESSGVFQQQDAHECWQKLLSILKITLKATVSDGSDVKLQHSYKCLE
SEDEMETMEFEDSLQLSCFIEQEVKYLHTGITKGLKGTIEKASPTLSRNASYQKVSAVTR
LPAYLTIQFVRFFHGRSGASEDLVSKKILKDVKFQLHFDAFDFCSPELKEKMLPIRRKYK
EVEDRKMAIQAKRITEGVIGKDSSKEASHVLYEPYSFREDPGSNNSGYYELIAVLTHRGR
SSSSGHYVAWVRKQPGQWFKYDDDDVTMVTDEEIKKLSGGGDWHMAYILVYGPRPLEIVK
EQQ
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgcctacatttgcagttaaggtaaaatggggtaaggtgaagtatgatgacttggaactc
aacactgatgagcctccagtgatatttaagagtcaactattctcactaacaggtgtacca
ctggagcgacagagactaatgattgctggtcaatccattggtgatgatacgtggactgat
cctgttatcaagaaaataaaaccaaactgtatgttcatgttaatgggttcagctgatgcc
ctacctactgcccccaaagagaagacaatattcattgaagatatgactgaagctgatgcc
gccagactacttgaggttccatttggtcttcataatcttggaaacacgtgctacatgaac
gcatcattacaatgtattagagccatacctgaactacgcagggaaatattagatttcact
ggtcatcatggactggtggaaggattagacgttgcttcacacgaactaacagcaagaatg
aatgaactcttcgtttcaatggagaaaagagagccacagcttgagctggccctattcctt
caaggtcttcaaacagttgttcctcattttgctactaaagacgaaagttccggagtattc
cagcagcaggacgctcacgagtgctggcaaaaactcctcagtatactcaagataactctc
aaggcaacggtaagtgatggaagtgatgttaaattgcagcatagttacaagtgccttgag
agtgaggatgagatggagactatggagtttgaggacagtctccagttgtcgtgcttcatt
gaacaagaagtgaagtacttgcataccggaataactaaaggtttaaaaggtaccatagag
aaggcctctccgacattatcaagaaatgctagctatcagaaagtgtctgcagtgactagg
ctgccggcctacctcacaatccagtttgtgaggttctttcacggccgatcaggggcatca
gaagatctcgtatcaaagaaaatcctaaaagatgtcaaatttcaattacattttgatgcg
tttgatttctgttctcctgaacttaaagaaaagatgctcccaatacgtaggaagtataaa
gaagttgaagatcgcaaaatggctattcaagctaagaggatcacggagggtgtgataggg
aaggactcttcaaaggaagctagtcatgtcctgtatgaaccatacagcttccgtgaagat
ccaggtagtaacaacagtggatactatgaactgatagcagtcctcactcacagaggaagg
agctcatcctctggacattatgtagcctgggttaggaagcaacctggtcaatggtttaaa
tatgatgatgatgatgtcacgatggtaacagatgaagaaattaaaaaactatcaggagga
ggggattggcatatggcatatatactggtgtatggccctagaccacttgaaatagtcaaa
gaacagcaatga

DBGET integrated database retrieval system