KEGG   Amphimedon queenslandica (sponge): 100642056Help
Entry
100642056         CDS       T02284                                 

Definition
dual specificity tyrosine-phosphorylation-regulated kinase 4-like
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 574 aa AA seqDB search
MGMSSTGVSMATRPSRHPTSSVETRDRSGTVPSLPQVGNVKDGKSRDQTWDIYGDTEQLL
LSPYSSRPRPSPSLIPRLKPSGSCRRSPSKQTTAGASVPDPHSRGRLYRSTSLRSDSDLD
GDSLPIPGIGGVPAAVPSTSRSRRNPQQSIRLPMTPSQAIKEYGHRLTGYEKKEILEYPD
VWFLGLESKKIEGVPGGSQNCGYDDENGSYIKVLHDHISYRYEIREIIGKGSFGQVVKVF
DHKTNQHIALKIIRNKKRFHHQALVEVKILDSLRKRDRDNQYNIIHMFDYFYFRNHLCIT
FELMGMNLYELIKKNNFQGFSISLIRRFAYSMLQCLKILYRERIIHCDLKPENILLRLRG
QSSIKVIDFGSSCYEHQRVYTYIQSRFYRSPEVILGLPYSMAIDMWSLGCILAELYTGYP
LFPGENEVEQLACIIEIFGLPDPALLAEAQRKKLFFDSRGNPRCVTNSKGKKRRPGSKDL
SSAIKTSDLLFLDFIRRCLVWSASERMKPEEALQHAWIQEVIFNFISSSCGVRFTTKSTG
TGNKTQRVYHHVIEFVNVQWVKDLLLERNMTYII
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggggatgtcctctaccggcgtttccatggcaacgagacccagcagacatcccacaagt
tcggtggaaactcgagatagaagcgggactgttccgtcattgcctcaagtgggaaacgtc
aaggatgggaaatcacgggatcagacctgggatatttatggcgatacagagcaactcctt
ctatctccttattcctcaaggccccgcccctctccctctctcattcccagactaaaaccc
tccggcagctgtaggagatcacccagtaaacagactacagctggtgctagtgttcctgat
cctcattctcgtggtcgactttatcgctcaacttctcttcgatcagacagtgacctagat
ggtgactcgttaccaatccctggtattgggggtgttccagctgctgttccctctacctcg
agatcacgccggaacccccagcagtccatacgtttaccaatgaccccgtcacaggccatt
aaagagtatgggcacaggctcactggctacgagaagaaggaaatcctggagtatcctgat
gtttggtttctgggtctggagtctaagaaaatcgaaggggtccccggggggtctcagaat
tgtggctacgatgatgaaaatgggagctatataaaggtccttcatgatcacatatcctat
cgatacgagataagagagatcatagggaaaggatcctttggacaagttgtaaaggttttt
gatcataaaaccaaccagcatattgctctcaagatcatacgaaataagaaaaggtttcat
caccaggcactggttgaagtcaaaatactggactcactgagaaaaagggatcgtgacaac
cagtataacatcatacacatgtttgactacttttacttcaggaaccacctctgcataaca
tttgaactaatgggtatgaatctctacgaattaatcaaaaagaataatttccaaggattt
agcatctctttgataagaagattcgcttactcaatgcttcaatgtctgaagatactctac
agagagagaatcatacactgtgacctcaaaccagagaatatactgctgagattgaggggg
cagagctctataaaggtgattgatttcggatcaagttgctacgagcatcaaagagtatac
acttacatacagtcaaggttttacagatcaccagaagtaatactcggtctcccttacagc
atggctattgacatgtggtccctgggctgtatattagccgaactgtacacaggctacccg
ttgttccctggcgaaaatgaagtggaacagttagcctgtatcatcgaaatatttggacta
cctgacccagcgttactagctgaggctcaaagaaaaaaattattttttgattcacgtggt
aatcctcgctgtgtcactaacagcaaaggaaagaagcgccgtcccgggagtaaagactta
agctcagccattaagacgagcgatctcctattccttgatttcatcagacggtgtttagtt
tggagtgctagtgaacgtatgaaacctgaagaggctttacagcacgcttggattcaagaa
gtaatatttaattttatatcttcatcctgtggggtccgattcacaaccaaaagtactgga
accggcaacaagacgcaacgggtctatcatcatgttattgaatttgttaatgtccaatgg
gttaaagatttgctacttgaacgtaatatgacgtatataatatag

DBGET integrated database retrieval system