KEGG   Amphimedon queenslandica (sponge): 100642056Help
Entry
100642056         CDS       T02284                                 

Definition
(RefSeq) dual specificity tyrosine-phosphorylation-regulated kinase 4-like isoform X2
  KO
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
aqu  Amphimedon queenslandica (sponge)
Brite
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100642056
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100642056
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
Unknown
AA seq 751 aa AA seqDB search
MALDLEMERGTGSTKERSFSYSKATPLLPSLTSPRGSENGGSHFDRSFMRKGISSLSLSE
RESKKSHFTHSLGGVHYNAPPLSINSVGRSKVTMGMSSTGVSMATRPSRHPTSSVETRDR
SGTVPSLPQVGNVKDGKSRDQTWDIYGDTEQLLLSPYSSRPRPSPSLIPRLKPSGSCRRS
PSKQTTAGASVPDPHSRGRLYRSTSLRSDSDLDGDSLPIPGIGGVPAAVPSTSRSRRNPQ
QSIRLPMTPSQAIKEYGHRLTGYEKKEILEYPDVWFLGLESKKIEGVPGGSQNCGYDDEN
GSYIKVLHDHISYRYEIREIIGKGSFGQVVKVFDHKTNQHIALKIIRNKKRFHHQALVEV
KILDSLRKRDRDNQYNIIHMFDYFYFRNHLCITFELMGMNLYELIKKNNFQGFSISLIRR
FAYSMLQCLKILYRERIIHCDLKPENILLRLRGQSSIKVIDFGSSCYEHQRVYTYIQSRF
YRSPEVILGLPYSMAIDMWSLGCILAELYTGYPLFPGENEVEQLACIIEIFGLPDPALLA
EAQRKKLFFDSRGNPRCVTNSKGKKRRPGSKDLSSAIKTSDLLFLDFIRRCLVWSASERM
KPEEALQHAWIQEGFHSRPRATPRALHISPSSSAGTPSSSSHYHSQTLPSHQQKPNGRHG
SSQPPSDISPGSVSYTDSSRRRLHPVGSDSQPKVLEPATRRNGYNKRNSLVIDSTGSVMR
GGGAFPIATAGETEHNDPSCRSPSTSSPPPQ
NT seq 2256 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgatctagaaatggaacgaggcactggctcaacaaaagaaagatctttctct
tactccaaagcaacccctctccttccttctctaacctcgccacgtggctctgaaaatgga
ggcagccattttgacaggagtttcatgcgaaaagggataagctctctttcccttagtgag
agagagtcgaagaagagtcattttacccatagcctgggaggggttcactataatgcacct
ccattgtcgataaattcagtcggtcgatcgaaagttactatggggatgtcctctaccggc
gtttccatggcaacgagacccagcagacatcccacaagttcggtggaaactcgagataga
agcgggactgttccgtcattgcctcaagtgggaaacgtcaaggatgggaaatcacgggat
cagacctgggatatttatggcgatacagagcaactccttctatctccttattcctcaagg
ccccgcccctctccctctctcattcccagactaaaaccctccggcagctgtaggagatca
cccagtaaacagactacagctggtgctagtgttcctgatcctcattctcgtggtcgactt
tatcgctcaacttctcttcgatcagacagtgacctagatggtgactcgttaccaatccct
ggtattgggggtgttccagctgctgttccctctacctcgagatcacgccggaacccccag
cagtccatacgtttaccaatgaccccgtcacaggccattaaagagtatgggcacaggctc
actggctacgagaagaaggaaatcctggagtatcctgatgtttggtttctgggtctggag
tctaagaaaatcgaaggggtccccggggggtctcagaattgtggctacgatgatgaaaat
gggagctatataaaggtccttcatgatcacatatcctatcgatacgagataagagagatc
atagggaaaggatcctttggacaagttgtaaaggtttttgatcataaaaccaaccagcat
attgctctcaagatcatacgaaataagaaaaggtttcatcaccaggcactggttgaagtc
aaaatactggactcactgagaaaaagggatcgtgacaaccagtataacatcatacacatg
tttgactacttttacttcaggaaccacctctgcataacatttgaactaatgggtatgaat
ctctacgaattaatcaaaaagaataatttccaaggatttagcatctctttgataagaaga
ttcgcttactcaatgcttcaatgtctgaagatactctacagagagagaatcatacactgt
gacctcaaaccagagaatatactgctgagattgagggggcagagctctataaaggtgatt
gatttcggatcaagttgctacgagcatcaaagagtatacacttacatacagtcaaggttt
tacagatcaccagaagtaatactcggtctcccttacagcatggctattgacatgtggtcc
ctgggctgtatattagccgaactgtacacaggctacccgttgttccctggcgaaaatgaa
gtggaacagttagcctgtatcatcgaaatatttggactacctgacccagcgttactagct
gaggctcaaagaaaaaaattattttttgattcacgtggtaatcctcgctgtgtcactaac
agcaaaggaaagaagcgccgtcccgggagtaaagacttaagctcagccattaagacgagc
gatctcctattccttgatttcatcagacggtgtttagtttggagtgctagtgaacgtatg
aaacctgaagaggctttacagcacgcttggattcaagaaggatttcatagtcgtcctcgt
gccacgcctagagcgttacacatctctccttcctcttcagctggtactccctcctcctcc
tctcattatcattctcagaccctcccctctcaccagcagaaacctaacggtcgtcatggc
agcagtcaaccgcccagtgacattagcccaggctctgtgagctataccgactcgagtagg
cggagacttcatcctgtggggtccgattcacaaccaaaagtactggaaccggcaacaaga
cgcaacgggtacaataagaggaactcgttagttattgatagcactgggagtgttatgaga
ggaggcggggcgtttcccatagcaactgctggtgagactgaacacaatgatccttcttgt
cgttcgccttcaacttcatctcctcctcctcaataa

DBGET integrated database retrieval system