KEGG   Amphimedon queenslandica (sponge): 100642122Help
Entry
100642122         CDS       T02284                                 

Definition
5'-AMP-activated protein kinase catalytic subunit alpha-2-like
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
aqu  Amphimedon queenslandica (sponge)
Pathway
FoxO signaling pathway
Regulation of autophagy
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aqu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100642122
   04150 mTOR signaling pathway
    100642122
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    100642122
Enzymes [BR:aqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100642122
Protein kinases [BR:aqu01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   100642122
Mitochondrial biogenesis [BR:aqu03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100642122
  Mitophagy factors
   Other mitophagy factors
    100642122
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 526 aa AA seqDB search
MDSIMEGKTPQKLKIGRYILGETLGTGTFGKVKIADHDLTGHKVAVKILNRNKIQHLDVA
DKITREIQILKLFRHPHIIKLYEVITTPKDIFMVMEYVSGGELFEYIVKHGKSSENESRA
FFQQIISGVDYCHRHKVVHRDLKPENLLLDSNNKVKIADFGLSNLMKDGEFLRTSCGSPN
YAAPEVVSGKLYAGPEVDVWSCGIILYALLCGSLPFEDTNISMLFRKIKSGQFYIPHYIS
KGASDLLTQMLQVNPVKRITLPQIKEHTWFTTELPQYLFPLPGLTEHHQIDSAVLSEVCQ
KLSVKREEVLQALRSGDRGHHLAVAYELVQDNRLMQSHTQPGDDSHLLATSPITSSFIIV
DTLLERDHSQKDSLTNASPVSSTGGGMTKHRSTSLVIEDSVPIRLPRSFKKPKWHLGIRS
QSHPQNIMQEIMKKLKALNFDWKVVNTYHIRCRYKKSADESSVVKLDLQLYQLDQRNFLL
DFKGVDPSEEKTEVSILGGGSPQLPQRHYTMEFFEACSRLICSLAQ
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggactcgatcatggagggaaagacaccacagaaactcaaaattggaaggtacatattg
ggtgagacactgggtacaggaacgtttggtaaagtgaagatagctgatcatgatctcaca
ggacacaaagtagcagtgaagatactcaacaggaataagatacaacacttggacgttgct
gataagatcacgagagagatccaaatattgaaattgtttcgtcatccgcacataataaag
ttgtacgaggttataactacaccaaaagatatattcatggtaatggaatatgtttcagga
ggagaattatttgaatatattgttaaacatggtaagagcagtgaaaatgaatccagggca
ttcttccagcagataatatctggtgtggattactgtcacagacacaaagttgtccatcgt
gacttaaagccagagaatcttctattggattctaacaacaaagtaaagatagccgacttt
ggattgtcaaacttgatgaaagatggagaatttctgaggactagctgtgggagtcctaat
tatgctgctcctgaagtagtctcgggaaaactttatgctggcccagaggttgatgtgtgg
agctgtggtattatactttatgctttgctttgtggtagtcttccatttgaagacacaaat
atctcaatgctgtttcgtaagataaagtctggccagttttatataccgcactacatcagt
aaaggggccagtgaccttttaacacagatgctacaggttaatcctgttaagcgtataaca
ctgccacagatcaaagagcatacatggtttactaccgagctaccccaatacctattccct
ctaccaggtctcactgagcatcatcaaatagactctgctgtgttgtctgaagtgtgtcag
aagctatcggtcaagagagaagaagtcttgcaggccctccgtagtggagacaggggccat
catttagcagttgcatatgagctagtacaggacaacagactaatgcagtcacacacgcaa
cctggtgatgattcgcatctgctggctacaagtccaatcacatcatcattcattattgtg
gatacattactagagagggatcattctcaaaaggatagtctgaccaatgcttctcccgtt
tcttccactggaggagggatgactaagcacagatcaacctcactagtgattgaagactca
gttccgatacgactcccacgctcttttaaaaaaccaaagtggcatcttggtatccgctct
cagtcacatcctcagaacataatgcaagaaataatgaaaaaattgaaagctttaaacttt
gactggaaggttgttaatacgtatcacattcgttgtcgatacaagaaatcggctgatgag
agcagtgtcgttaaactggatcttcagctctatcagttggatcaacgtaactttctactt
gactttaaaggcgttgatccatctgaagagaagactgaagtgagtattcttggtggagga
tctccccaattgccccaaagacattacacaatggagttctttgaggcttgctcaagactc
atttgctctctagctcaataa

DBGET integrated database retrieval system