KEGG   Agrobacterium radiobacter: Arad_0026Help
Entry
Arad_0026         CDS       T00850                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arad_0026 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_0026 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arad_0026 (trpB)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arad_0026 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:18743..19957
Genome map
AA seq 404 aa AA seqDB search
MNQTPKLNSFRAGPDEDGRFGIYGGRFVAETLMPLILDLQEEWEKAKNDPAFQAELKSLG
THYIGRPSPLYFAERLTAELGGAKIYFKREELNHTGSHKINNCIGQILLAKRMGKTRIIA
ETGAGQHGVASATVAARFGLPCVVYMGATDVERQAPNVFRMKLLGAEVIPVTAGSGTLKD
AMNEALRDWVTNVDDTYYLIGTAAGPHPYPEMVRDFQAVIGTEAKQQMLEAEGRLPDLVI
AAVGGGSNAIGIFHPFLDDESVKIVGVEAGGKGLQGDEHCASITAGSPGVLHGNRTYLLQ
DGDGQIKEGHSISAGLDYPGIGPEHSWLNDIGRAEYVPIMDHEALEAFQTLTRLEGIIPA
LEPSHALAEVIKRAPKMGKDEIILMNLSGRGDKDIFTVAKILGM
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccagacgccaaagctgaattccttccgcgccggtcccgatgaggatggccgtttc
ggtatttatggtggccgcttcgtcgctgagacgttgatgccgctgatcctggacctgcag
gaagaatgggaaaaggcgaagaacgatccagccttccaggcggagctgaagtcgctcggt
acccattatatcggccgcccgagcccgctttatttcgccgagcgcctgacggccgagctt
ggcggcgccaagatctatttcaagcgcgaagagctgaaccataccggctcgcacaagatc
aacaattgcatcggccagatcctgcttgccaagcgcatgggcaagacccgcatcatcgcc
gagaccggcgccggccagcatggtgttgcctcggcgaccgttgccgcacgcttcggcctg
ccctgcgtcgtctacatgggcgcgaccgatgtcgagcgtcaggctccgaacgttttccgc
atgaagcttctgggcgccgaagtcattccggtgacggccggcagcggcacgctgaaggac
gccatgaacgaggctcttcgcgattgggtcaccaatgtcgacgacacctattacctgatc
ggcacggctgccggcccgcatccctatccggaaatggtccgcgacttccaggccgtgatc
ggcacggaagccaagcagcagatgctggaagctgaaggccgcctgccggatctcgttatc
gctgctgtcggcggcggttcgaacgcgatcggcatcttccatcccttcctcgatgacgag
agcgtcaagatcgtcggcgtcgaagccggcggcaagggcctgcagggcgacgagcattgc
gcctcgatcaccgccggttcgcccggcgtactgcacggcaaccgcacctacctgctgcag
gacggcgacggccagatcaaggaaggacattcgatttcggctggcctcgactatcccggt
attggcccggaacattcctggctgaacgatatcggccgcgccgaatatgtgccgatcatg
gaccatgaagcgctggaagcgttccagacgctgacgcgccttgaaggcatcattccggcg
ctggagccgagccacgccctcgccgaagtcatcaagcgcgcgccgaagatgggcaaggac
gagatcatcctgatgaatctctccggtcgcggcgacaaggacatcttcaccgtggccaag
attttgggaatgtga

DBGET integrated database retrieval system