KEGG   Agrobacterium radiobacter: Arad_0028Help
Entry
Arad_0028         CDS       T00850                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arad_0028 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_0028 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arad_0028 (trpA)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arad_0028 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:19968..20807
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAALKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGADVIELGMPFSDPMA
DGPAIQLAGQRALKAGQTLKKTLQLAADFRKTDGDTPIVLMGYYNPIYIYGVETFLDDAI
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPAVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVKRIKQHTDLPVCVGFGVKTAEHAKLIGASADGVVVGTAIVNQ
IATSLTKDGKAGADTIQAVATLVRGLSTGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtatggacaaacgcttcgccgctctgaaggctgaaggccgcccggcgctc
gtcacctatttcatgggcggcgatcccgattacgacacctcgctcggcattatgaaggcg
ctgccggaagccggcgccgacgtcatcgagctcggcatgcccttttccgacccgatggcc
gacggcccggcgatccagctcgccggtcagcgcgcgctgaaggccggccagacgctgaag
aagacgctgcagctcgccgccgatttccgcaagacggacggcgatacgccgatcgtgctg
atgggctactacaatcccatctatatctatggcgtcgagaccttcctcgatgacgcgatc
gccgccggtatcgacggcctgatcgttgtcgacctgccgccggaaatggatgacgagctc
tgcatcccggcgatccgcaagggcatcaacttcatccgcttggcaacaccgaccaccgat
gaaaagcgcctgccggccgtgctgaaaaatacatccggcttcgtctattatgtctcgatg
aacggcatcaccggttcggccctgccggatccgtcgctggtctccggtgccgtcaagcgc
atcaagcagcataccgatctgccggtctgcgtcggcttcggcgtcaagacggccgagcat
gcgaagcttatcggcgcctccgcggatggcgtcgtcgtcggtacggcgatcgtcaatcag
atcgccaccagcctgaccaaggacggcaaggccggcgccgataccatccaggccgttgcg
acactggtgcgcggcctgtcgacgggaacgcgctccgcgcgccttgttgccgccgaataa

DBGET integrated database retrieval system