KEGG   Agrobacterium radiobacter: Arad_0028Help
Entry
Arad_0028         CDS       T00850                                 

Gene name
trpf
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ara  Agrobacterium radiobacter
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Arad_0028 (trpf)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Arad_0028 (trpf)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Arad_0028 (trpf)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Arad_0028 (trpf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:19968..20807
Genome map
AA seq 279 aa AA seqDB search
MTARMDKRFAALKAEGRPALVTYFMGGDPDYDTSLGIMKALPEAGADVIELGMPFSDPMA
DGPAIQLAGQRALKAGQTLKKTLQLAADFRKTDGDTPIVLMGYYNPIYIYGVETFLDDAI
AAGIDGLIVVDLPPEMDDELCIPAIRKGINFIRLATPTTDEKRLPAVLKNTSGFVYYVSM
NGITGSALPDPSLVSGAVKRIKQHTDLPVCVGFGVKTAEHAKLIGASADGVVVGTAIVNQ
IATSLTKDGKAGADTIQAVATLVRGLSTGTRSARLVAAE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgtatggacaaacgcttcgccgctctgaaggctgaaggccgcccggcgctc
gtcacctatttcatgggcggcgatcccgattacgacacctcgctcggcattatgaaggcg
ctgccggaagccggcgccgacgtcatcgagctcggcatgcccttttccgacccgatggcc
gacggcccggcgatccagctcgccggtcagcgcgcgctgaaggccggccagacgctgaag
aagacgctgcagctcgccgccgatttccgcaagacggacggcgatacgccgatcgtgctg
atgggctactacaatcccatctatatctatggcgtcgagaccttcctcgatgacgcgatc
gccgccggtatcgacggcctgatcgttgtcgacctgccgccggaaatggatgacgagctc
tgcatcccggcgatccgcaagggcatcaacttcatccgcttggcaacaccgaccaccgat
gaaaagcgcctgccggccgtgctgaaaaatacatccggcttcgtctattatgtctcgatg
aacggcatcaccggttcggccctgccggatccgtcgctggtctccggtgccgtcaagcgc
atcaagcagcataccgatctgccggtctgcgtcggcttcggcgtcaagacggccgagcat
gcgaagcttatcggcgcctccgcggatggcgtcgtcgtcggtacggcgatcgtcaatcag
atcgccaccagcctgaccaaggacggcaaggccggcgccgataccatccaggccgttgcg
acactggtgcgcggcctgtcgacgggaacgcgctccgcgcgccttgttgccgccgaataa

DBGET integrated database retrieval system