KEGG   Agrobacterium radiobacter: Arad_0071Help
Entry
Arad_0071         CDS       T00850                                 

Gene name
glcB
Definition
(RefSeq) malate synthase G
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ara  Agrobacterium radiobacter
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_0071 (glcB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Arad_0071 (glcB)
   00630 Glyoxylate and dicarboxylate metabolism
    Arad_0071 (glcB)
Enzymes [BR:ara01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Arad_0071 (glcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:57405..59573
Genome map
AA seq 722 aa AA seqDB search
MSRIEKNGLQIEPVLYDFLVKEALPGSGVDADTFFAGFSAIVHDLAPKNRELLAKRDRMQ
AAIDDWYRKNGAPVDLAAYEAFLREIGYIIPEGPAFTVSTANVDTEIASIAGPQLVVPVM
NARYALNAANARWGSLYDALYGTDAIPETDGAEKGKGYNPKRGEKVIAWVRDFLDAAVPL
SDASWKDVAGFAVKGGVLAIATKSGTVALTDERHFAGYLGDVAAPSHILLKNNGIHIEIV
LDPSTDIGKVDPAHISDVRLESAITTIMDCEDSIAAVDAEDKAEVYRNWLGLMKGDLTEE
VAKGGKTFTRRLNPDVTYTAPDGASFELHCRSLMLIRNVGHLMTNPAILDRDGNEVPEGI
MDAMITGLIALYDVGPKGRRKNSRAGSMYVVKPKMHGPEEVAFAVEIFSRVEDVLGMPRN
TIKMGIMDEERRTTVNLKEAIRAASERVVFINTGFLDRTGDEIHTSMEAGPMIRKGDMKQ
AAWIAAYENWNVDIGLECGLSGHAQIGKGMWAMPDLMAAMLEQKIAHPKAGANTAWVPSP
TAATLHATHYHKVNVANVQQTLKSRVRAKLSDILSVPVASRPNWTPEEIQHEIDNNCQGI
LGYVVRWVDQGVGCSKVPDINNIGLMEDRATLRISAQHMANWLHHKVITEAQIVETMKRM
ATVVDQQNAGDPLYIAMAGNFDGSVAFQAALELVLKGREQPNGYTEPVLHRRRIELKAKQ
AV
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcatcgagaaaaacgggcttcagatcgaaccggtcctgtatgatttcctcgtc
aaggaggccctgccgggctccggcgtcgacgcggataccttctttgccggtttctcggcg
atcgtccatgacctcgctccgaagaaccgcgagctgcttgccaagcgcgaccggatgcag
gcggcgatagacgattggtatcgcaagaacggcgcaccggtggatctcgccgcctacgaa
gccttcctgcgcgagatcggctacatcattcccgaaggcccggccttcacggtttcgacc
gccaatgtcgacaccgaaatcgcctccatcgccggcccgcagctcgtcgttccggtcatg
aacgcccgctatgcactgaacgccgccaatgcgcgctggggttcgctctatgatgcgctc
tacggcaccgacgccatccccgaaactgatggcgccgagaagggcaaaggctacaatccg
aagcgcggcgagaaggtcatcgcctgggtgcgcgatttcctcgacgctgctgtgccgctt
agcgatgccagctggaaggacgtcgcgggctttgccgttaagggtggagttctggcgatt
gcgacgaagagcggcactgtcgctcttaccgacgaaaggcatttcgccggttatctcggc
gatgtcgctgcaccctcacatattctcctgaagaacaatggcatccatatcgagatcgtc
ctcgatccaagtactgatatcggcaaggtcgatccggcgcatatttccgatgtccggttg
gaatcagcgatcaccacgatcatggactgcgaagattccatcgccgccgtcgatgccgag
gacaaggccgaggtctatcgcaactggctcggcctgatgaagggcgacctgacggaggaa
gtcgccaagggcggcaagaccttcacgcgccgcctcaatcccgatgtgacctatacggca
cccgatggtgccagcttcgagctgcattgccgctcgctgatgctgatacgcaatgtcggt
cacctgatgaccaatccggcgatcctcgaccgtgacggcaacgaagtgccggaaggcatc
atggatgccatgatcaccggtctgatcgcgctttatgacgtcggccccaaaggccgccgc
aagaattcccgcgccggctcgatgtatgtcgtcaagccgaagatgcacgggccggaagaa
gtcgccttcgccgtcgagatcttctcgcgggtcgaagacgtgctcggcatgccgcgcaac
accatcaagatgggcatcatggacgaggagcgccgcaccacggtcaacctcaaggaagcc
atccgcgccgccagcgagcgcgtcgtcttcatcaataccggcttccttgatcgcaccggc
gacgagatccatacctcgatggaagccggcccgatgatccgcaagggcgacatgaagcag
gccgcctggatcgcggcctacgagaactggaacgtcgatatcggcctggaatgcggcctt
tccggccatgcgcagatcggcaagggcatgtgggccatgccggacctgatggcggcgatg
ctggaacagaagatcgcccatccaaaagccggcgccaacaccgcctgggtgccgtcgccg
acggccgcgacactgcatgccacgcattatcacaaggtcaatgttgccaatgtccagcag
accctgaagagccgcgtccgcgccaaactttccgatatcctctccgtgccggtcgcctcg
cgcccgaactggacgccggaagagatccagcacgagatcgacaataattgccagggcatc
ctcggctatgtcgtccgttgggtcgatcagggcgtcggctgctcgaaggtgccggatatc
aacaatatcggcctgatggaggatcgtgccacgctgcgcatctcggcgcagcacatggcc
aactggctgcaccacaaggtcatcaccgaggcacagattgttgagacgatgaagcgcatg
gccaccgtggtcgaccagcagaatgccggtgacccgctctacatcgccatggccggcaat
ttcgatggctcggttgccttccaggccgcgctcgagctcgtgctcaaaggccgcgaacag
ccgaacggctataccgagccggtcctgcaccgccgccgcatcgaactgaaggcgaagcag
gccgtatag

DBGET integrated database retrieval system