KEGG   Agrobacterium radiobacter: Arad_0196Help
Entry
Arad_0196         CDS       T00850                                 

Gene name
cycM
Definition
(GenBank) cytochrome-c protein
  KO
K08738  cytochrome c
Organism
ara  Agrobacterium radiobacter
Pathway
ara02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ara00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Arad_0196 (cycM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Haem_bd
Motif
Other DBs
NCBI-ProteinID: ACM24947
UniProt: B9JGV1
Position
1:173818..174405
Genome map
AA seq 195 aa AA seqDB search
MNSSYVNMGVGALLATLFVLKSVSLASGFIFHSETPEKPGFEIVAAEAPAGDAGGKAAEA
KETPIAQLLQTADAKVGETIFKKCQACHSGEKGGPNKVGPDLWGIVDRPVAEHEGFAYSA
AIKGFSKDGAEKWTYDHLYHFVAAPKKFISGTAMGFAGLPKEKDRADLIAYLRTLADTPV
PLPDPNAAPAPAATN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgaattcatcctacgtgaacatgggtgtcggggcacttctagccacacttttcgtgctg
aagtccgtgtcgctcgcgtcaggatttattttccattcagagacgccggaaaagcccggc
ttcgaaattgtcgccgccgaagcaccggccggggatgccggcggcaaggctgccgaggca
aaggaaacgccgatcgcgcaattgctgcagacggcagacgccaaggtcggcgaaacgatc
ttcaagaagtgtcaggcctgtcattccggggaaaagggagggccaaacaaggttggcccc
gatctctggggcatcgtcgaccgtccggtcgccgaacatgagggctttgcctattccgcc
gccatcaaaggcttttccaaggacggcgcggagaagtggacctacgatcatctttatcac
ttcgtagccgcgccgaagaagttcatttccggaacggccatgggctttgccggcctgccg
aaggaaaaggaccgcgccgacctgatcgcctatctgcgcacgctggctgatacgccggtg
ccgctgccggacccgaatgcagcgccggcgccggctgcgacgaactag

DBGET integrated database retrieval system