KEGG   Agrobacterium radiobacter K84: Arad_0347Help
Entry
Arad_0347         CDS       T00850                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ara00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:303322..304629
Genome map
AA seq 435 aa AA seqDB search
MIPQEIIRLKRNGGILSAADINSFIGALARGELAESQIGAFAMAVWFRGMTREEVVALTL
AMARSGDTLAWSGIGRPIVDKHSTGGVGDNVSLMLAPIAAACGLAVPMISGRGLGHTGGT
LDKLESIPGYGITPDAARFRKVVDEVGCAIIGQTGALAPADGKLYAVRDVTATVDSVPLI
TASILSKKLAAGLETLVLDVKIGSGAFMTSAEEAETLARSLVEVANGAGVKTSALITDMN
QPLADAAGNVVELRNCLDFLKGGKAGTRLETVVLAFAAEMLTQAGVEKTLAEAEASARDA
LASGKAAELFGRMVHGLGGPVDLLENPAKYLAVAPVHKPILASSDGWLAACDARAIGMGV
IDLGGGRRRPEDKIDHRVGFSDILPLGTKVSKGDRIATVHAADDASAEKAAADLAANYRI
ADTAPILPPVIVSRI
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcccgcaggaaatcatccggctgaagcgcaacggcggcattctttcagccgccgat
atcaatagcttcatcggagccctggcgcgtggcgagctggcggaaagccagatcggcgcc
tttgccatggccgtctggtttcgcggcatgacgcgcgaggaggtcgtggcgctgacactc
gccatggcccgttccggcgacacgctcgcctggtccggcatcggcaggccgatcgtcgac
aagcattcgaccggcggcgtcggcgacaatgtctcgctgatgctggctccgatcgccgct
gcctgcggccttgccgtgccgatgatttccggtcgcggtctcggccataccggcggcacg
ctcgacaagctggaatcgatacccggctacggcatcactccggacgcggcgcgcttccgc
aaggtggtggacgaggtcggttgcgccatcatcggccagaccggagccttggcgcccgcc
gacggcaagctctatgccgtgcgcgatgtcacggccaccgtcgattccgtgccgctgatc
accgcctcgatcctatcgaagaaactggccgccgggctggaaacgctggtgctcgacgtc
aagatcggcagcggcgccttcatgacctcagcggaagaggccgagacgctggcccgttct
ctggtcgaggtggcgaacggggcgggggtgaagacctcggcactgatcaccgacatgaac
cagccgctggcggacgccgccggcaatgtcgtcgagcttcgcaattgcctggatttcctg
aagggcggcaaggcgggcacgcggctggagacggtcgtcttggccttcgcggccgaaatg
ctgacgcaggcgggggtcgaaaagacacttgccgaggccgaagccagcgcccgcgatgcg
cttgcctccggcaaggctgccgaattgttcggccgcatggttcatggtctcggcggtccg
gtcgatcttctggagaatccggctaaatatctggccgtcgcgccggtgcataagccaatt
ctcgcgtcttcggatggctggcttgcggcctgcgatgctcgcgccatcggtatgggtgtc
atcgatcttggcggcggccgccgtcgtcctgaggacaagatcgaccatcgtgtcggtttc
agcgatatcctgccactaggaacaaaggtgagcaaaggcgatcgtatcgcaaccgttcac
gcggctgatgatgcaagcgccgaaaaagccgcagccgatctcgccgcaaactatcgcatc
gcggataccgctcccattttgccgccggtgatcgtctcgcggatctga

DBGET integrated database retrieval system