KEGG   Agrobacterium radiobacter K84: Arad_0393Help
Entry
Arad_0393         CDS       T00850                                 

Gene name
egl
Definition
endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ara00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(338844..339923)
Genome map
AA seq 359 aa AA seqDB search
MAGSMTRLLRRSLAATVMLAFVAEADPSLAASQLCYRGINLSGAEYGERGGVLGTNYIYP
SEDTVRYFAGKGMNVVRLPFRWERLQPVLNQPLDGKELQNLKDAVDLIQKHGMAVILDPH
NYGYYDKIQLPQMPATDLAFGDFWARLAVEFANRKGVSFGLMNEPHDIKAPDWLELANTA
IRSIRTVGARNLILVPGTNWTGAHSWSADVLGGGANGTVMLGVKDPLNFYAFEFHQYLDA
DSSGTHPACDGTANGTKGMNDVTDWLRKNGKRGFLGEFGVAGNDGCLAGLKQVLGIMNDN
SDVWLGWSYWAAGDWWAPDEPLNVQPHDGRDKPQIKVLADGLSKKVSLAPACALIKPAN
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggccggatcgatgacgagactgctgcgccggtcgcttgcggctaccgttatgctcgcc
ttcgtcgctgaggcagaccctagccttgctgcgtcgcagctctgttatcgaggcatcaat
ctctccggcgccgaatatggcgagcgtggcggcgtgctcggcaccaattacatctaccct
tccgaagacacggtgcgctatttcgcgggcaaggggatgaacgtggtgcgcctgcccttt
cgctgggagcggctgcagcccgtattgaaccagccgctcgacggaaaggagctgcaaaac
ctcaaggatgccgtcgatctcattcaaaagcatggcatggccgtgatcctcgatccgcac
aattacggctactacgacaagatccagctcccgcagatgccggcgaccgatctcgccttc
ggcgacttctgggcgcggctcgccgtcgagttcgccaatcgcaagggtgtctccttcggc
ctgatgaacgagccgcacgatatcaaggcgcccgattggctggagctggccaacacggcc
atccgtagcatccgcaccgtcggcgcgcgcaacctcatcctcgtgcccggcacgaactgg
accggcgcgcatagctggtctgccgatgtccttggcggcggcgcaaacggcacggtcatg
ctcggcgtcaaggatccgctcaatttctacgctttcgaattccatcaatatctcgatgcg
gacagctccggtacccatccggcctgcgacggcaccgccaacggcaccaaaggtatgaac
gacgtcaccgactggctgcgcaagaacggcaagcgcggcttcctcggcgaattcggcgtg
gccggcaatgacggctgtcttgcgggcctcaaacaggtgctcggcatcatgaacgacaac
agcgacgtctggctcggctggagctactgggcggccggcgactggtgggcgccggacgag
ccgctgaacgtccagccgcacgacggccgtgacaagccacagataaaagtgctggcggat
ggcctgagcaagaaggtttcgctggcgccagcatgcgccctcatcaagcctgcaaactga

DBGET integrated database retrieval system