KEGG   Agrobacterium radiobacter K84: Arad_0597Help
Entry
Arad_0597         CDS       T00850                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ara03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:493707..494546
Genome map
AA seq 279 aa AA seqDB search
MEGAVLAALELRRNDLRFPFPAEFSRLASGRGITSLSRRAKYLLIDLDDGMTIIAHLGMS
GSFRVETGAVAETPGEFHHPRSKDEKHDHVIFHLTGANGPARVIYNDPRRFGFMDIARRA
DLGSHPSFRDLGPEPTGNTLSADYLAERFSGKAQPLKSALLDQKNIAGLGNIYVCEALWR
SHLSPVRAAGSLVTQAGRPSEELLRLVEAIREVIADAIAAGGSSLRDHIQTDGSLGYFQH
SFSVYDREAQPCGTPGCGGTVARIVQSGRSSFYCASCQT
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggaaggggcggtgcttgccgcgctggaactgcggcgcaacgacctgcgctttcccttt
ccggccgagttttcacgcctcgcctccggtcgcggcatcacgtcgctgtcgcgccgcgcg
aaatatctgctgatcgatctcgatgacggcatgacgatcatcgcgcatctcggcatgtcc
ggctcctttcgcgtcgaaaccggcgcggtcgcagagaccccgggcgagtttcatcacccg
cgctccaaggacgaaaagcacgatcacgtcatcttccatctgacgggtgccaacggaccc
gcgcgtgtcatctataacgatccccgccgcttcggcttcatggatattgccaggcgcgcc
gatctcggcagccacccgtcttttcgcgatctcggcccggagccgaccggcaatacattg
agtgccgattatctggccgagcgcttctcaggcaaggcgcagccgctgaaaagcgcactg
cttgaccagaagaacatcgccggtctcggcaatatatatgtgtgcgaggcgctgtggcgc
tcgcatctgtcgccggtgcgcgccgccggcagtttggtcacccaggccggcagaccgagc
gaggaattgctccggttggtcgaggcgattcgcgaggtcattgcagacgcgatcgcggcg
ggcggttcgtccctgcgcgaccatatccagacggatggttcacttggctatttccagcat
tctttttccgtctacgaccgcgaagcccagccttgcggcacgcccggctgcggcggtacg
gtcgcccgcatcgtccagtcgggccgctcttctttctattgcgcgtcctgccagacctga

DBGET integrated database retrieval system