KEGG   Agrobacterium radiobacter: Arad_0598Help
Entry
Arad_0598         CDS       T00850                                 

Gene name
fadB1
Definition
(GenBank) enoyl-CoA hydratase protein
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ara  Agrobacterium radiobacter
Pathway
ara00071  Fatty acid degradation
ara00280  Valine, leucine and isoleucine degradation
ara00281  Geraniol degradation
ara00310  Lysine degradation
ara00360  Phenylalanine metabolism
ara00362  Benzoate degradation
ara00380  Tryptophan metabolism
ara00410  beta-Alanine metabolism
ara00627  Aminobenzoate degradation
ara00640  Propanoate metabolism
ara00650  Butanoate metabolism
ara00903  Limonene and pinene degradation
ara00930  Caprolactam degradation
ara01100  Metabolic pathways
ara01110  Biosynthesis of secondary metabolites
ara01120  Microbial metabolism in diverse environments
ara01130  Biosynthesis of antibiotics
ara01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arad_0598 (fadB1)
   00650 Butanoate metabolism
    Arad_0598 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    Arad_0598 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_0598 (fadB1)
   00310 Lysine degradation
    Arad_0598 (fadB1)
   00360 Phenylalanine metabolism
    Arad_0598 (fadB1)
   00380 Tryptophan metabolism
    Arad_0598 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arad_0598 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arad_0598 (fadB1)
   00281 Geraniol degradation
    Arad_0598 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_0598 (fadB1)
   00627 Aminobenzoate degradation
    Arad_0598 (fadB1)
   00930 Caprolactam degradation
    Arad_0598 (fadB1)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arad_0598 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: ACM25252
UniProt: B9J7T0
Position
1:494580..495353
Genome map
AA seq 257 aa AA seqDB search
MAYETLIVETHGAVGLIRLNRPQALNALNSTVLTELRQAYAAFHADDAIGAIVLTGSEKA
FAAGADIKEMQPLDFADVYKGDLMSGWDEIAKARKPVIAAVSGFALGGGCELAMMCDFII
AADTAKFGQPEITLGIIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERSGLVSRIV
PADKLIDEALAAAAKIASLSRPSVLMAKEAVNRALETTLEEGLRFERRLFHSLFATEDQK
EGMAAFIEKRKPVFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaaaccctgatcgtcgaaacgcatggagcggtcggtctcatccggttgaac
cggccgcaggcgctgaatgcgctgaattcgaccgtattgaccgagttgaggcaggcctat
gccgcctttcacgccgatgatgccatcggcgcgatcgtgctcaccggctcggaaaaggcc
tttgccgccggcgccgatatcaaggagatgcagccgctcgacttcgccgatgtctacaag
ggcgatttgatgagcggctgggacgagatcgccaaggcccgcaagcccgtcatcgccgcc
gtcagcggtttcgcgctcggcggcggctgcgaactcgccatgatgtgcgacttcatcatt
gccgccgatacggcgaagttcggccagccggagatcacgctcggcatcatccccggcatg
ggcggctcgcagcgcctgacgcgcgctgtcggcaaggccaaggcgatggacctggttttg
accggccggatgatggatgcggccgaagcggagcgttccggcctggtgtcccgcattgtg
ccggccgacaagctgatcgatgaggcgctcgccgccgccgccaagatcgcttcgctgtcg
cgcccctcggtgctgatggccaaggaggccgtcaaccgggcgctggagacgacgctggaa
gaggggctgcgcttcgagcgccggctcttccacagcctgtttgccaccgaggatcagaag
gaaggcatggcggctttcatcgagaagcgcaaacccgtcttcaagaacaggtga

DBGET integrated database retrieval system