KEGG   Agrobacterium radiobacter: Arad_0598Help
Entry
Arad_0598         CDS       T00850                                 

Gene name
fadB1
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ara  Agrobacterium radiobacter
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Arad_0598 (fadB1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arad_0598 (fadB1)
   00650 Butanoate metabolism
    Arad_0598 (fadB1)
  Lipid metabolism
   00071 Fatty acid degradation
    Arad_0598 (fadB1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_0598 (fadB1)
   00310 Lysine degradation
    Arad_0598 (fadB1)
   00360 Phenylalanine metabolism
    Arad_0598 (fadB1)
   00380 Tryptophan metabolism
    Arad_0598 (fadB1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arad_0598 (fadB1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arad_0598 (fadB1)
   00281 Geraniol degradation
    Arad_0598 (fadB1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Arad_0598 (fadB1)
   00627 Aminobenzoate degradation
    Arad_0598 (fadB1)
   00930 Caprolactam degradation
    Arad_0598 (fadB1)
Enzymes [BR:ara01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arad_0598 (fadB1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:494580..495353
Genome map
AA seq 257 aa AA seqDB search
MAYETLIVETHGAVGLIRLNRPQALNALNSTVLTELRQAYAAFHADDAIGAIVLTGSEKA
FAAGADIKEMQPLDFADVYKGDLMSGWDEIAKARKPVIAAVSGFALGGGCELAMMCDFII
AADTAKFGQPEITLGIIPGMGGSQRLTRAVGKAKAMDLVLTGRMMDAAEAERSGLVSRIV
PADKLIDEALAAAAKIASLSRPSVLMAKEAVNRALETTLEEGLRFERRLFHSLFATEDQK
EGMAAFIEKRKPVFKNR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atggcctacgaaaccctgatcgtcgaaacgcatggagcggtcggtctcatccggttgaac
cggccgcaggcgctgaatgcgctgaattcgaccgtattgaccgagttgaggcaggcctat
gccgcctttcacgccgatgatgccatcggcgcgatcgtgctcaccggctcggaaaaggcc
tttgccgccggcgccgatatcaaggagatgcagccgctcgacttcgccgatgtctacaag
ggcgatttgatgagcggctgggacgagatcgccaaggcccgcaagcccgtcatcgccgcc
gtcagcggtttcgcgctcggcggcggctgcgaactcgccatgatgtgcgacttcatcatt
gccgccgatacggcgaagttcggccagccggagatcacgctcggcatcatccccggcatg
ggcggctcgcagcgcctgacgcgcgctgtcggcaaggccaaggcgatggacctggttttg
accggccggatgatggatgcggccgaagcggagcgttccggcctggtgtcccgcattgtg
ccggccgacaagctgatcgatgaggcgctcgccgccgccgccaagatcgcttcgctgtcg
cgcccctcggtgctgatggccaaggaggccgtcaaccgggcgctggagacgacgctggaa
gaggggctgcgcttcgagcgccggctcttccacagcctgtttgccaccgaggatcagaag
gaaggcatggcggctttcatcgagaagcgcaaacccgtcttcaagaacaggtga

DBGET integrated database retrieval system