KEGG   Agrobacterium radiobacter: Arad_0816Help
Entry
Arad_0816         CDS       T00850                                 

Gene name
fadB2
Definition
enoyl-CoA hydratase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ara  Agrobacterium radiobacter
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ara00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Arad_0816 (fadB2)
   01212 Fatty acid metabolism
    Arad_0816 (fadB2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Arad_0816 (fadB2)
   00650 Butanoate metabolism
    Arad_0816 (fadB2)
  Lipid metabolism
   00071 Fatty acid degradation
    Arad_0816 (fadB2)
   01040 Biosynthesis of unsaturated fatty acids
    Arad_0816 (fadB2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Arad_0816 (fadB2)
   00310 Lysine degradation
    Arad_0816 (fadB2)
   00380 Tryptophan metabolism
    Arad_0816 (fadB2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Arad_0816 (fadB2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Arad_0816 (fadB2)
   00281 Geraniol degradation
    Arad_0816 (fadB2)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Arad_0816 (fadB2)
Enzymes [BR:ara01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Arad_0816 (fadB2)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Arad_0816 (fadB2)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Arad_0816 (fadB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:671118..673328
Genome map
AA seq 736 aa AA seqDB search
MAYTNFTIETDADGIALVTWDMPGKSMNVFTSEVMDELNAIIDATVADAAVKGVVFTSSK
SSFSGGADLSMIKSMFSFYQDEKAKEPAGAAQKLFDLVGRMTGLFRKLETCGKPWVSAIN
GTCMGGAFELSLACHGRVASSAKSVKIALPEVKVGIFPGAGGTQRVSRLTDAQSALQMMT
TGQSLTAVRAKAMNLVHQVVEPDQLIPAAKQMIKDGLKPVAPWDEKGFKAPGGGIWTPAS
AQLWPAAPAILRRETSGNYPAALAILKCVYEGLQVPFDTGLKIEQRYFTQVLQTTEAYSM
IRSLFISMQELGKGARRPAGQLKTVLKKVGVVGAGFMGASIAYVTAAAGLSVTLIDRDLE
AAGKGKSVGEGLVKDAVGKGRMTQEDGAALLSRITPSATYADLSDADLVIEAVFEDREVK
KAVIEAVEAVLPEGAIFASNTSTLPISGLAKNSKRPADFIGVHFFSPVEKMMLTEVILGK
ETGDRALAVALDYVAAIKKTPIVVNDTRGFFVNRCVFRYIHEAYDMLIEGVPATMIENAA
KMAGMPVGPLALNDEVAIDLSLKILKATVADLGEKAVDPRHMQLISRLVEGEGRLGRKNS
KGFYDYPPKPAKKSLWLGLKDLYPQKKADEIDVAVLKQRFLATIALEAARTMEEGIVTDP
READVGSILGFGFAPYTGGALSYIDGMGVKAFVSLCETLAKTYGPHFAPTALLKDMAAKG
ETFYGRFDPYSVKAAA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atggcttacacaaatttcaccatcgagaccgacgcagacggcatcgcgctcgttacctgg
gacatgcccggaaaatccatgaacgtcttcacctccgaggtgatggacgaactgaacgcc
atcatcgacgcgaccgttgccgacgcggcggtcaagggcgtggtcttcacctcgagcaag
tcctccttctccggcggcgctgatctctcgatgatcaagtcgatgttctccttctatcag
gatgagaaggcgaaagagccggccggcgccgcgcagaaactcttcgatcttgtggggcgc
atgaccggcctcttccgcaagctcgaaacctgcggcaagccgtgggtttccgccattaac
ggcacttgcatgggtggtgccttcgagctgtcgctggcctgccacggccgcgttgcgtcc
agcgcgaaaagcgtcaagatcgctctgccggaagtcaaggtcggcattttccccggcgct
ggcggcacgcaacgtgtgtcgcgattgaccgacgcgcaatcggccttgcagatgatgacg
acaggccagtcgctgacggcggtgcgcgccaaggcaatgaacctggttcatcaggtggtc
gagccggatcagttgatcccggccgccaagcagatgatcaaggacgggctgaagccggtc
gcaccctgggacgaaaagggcttcaaggcccccggcggcggtatctggacgccggcctcg
gcccagctctggccggctgctccggccatcctgcgccgagagacatcgggcaattatccg
gcggcgctcgccatcctaaaatgtgtctatgaaggcctccaggtgcctttcgacaccggc
ctgaagatcgagcaacgctatttcacccaggtgctgcagaccactgaagcctattcgatg
atccgctcgctgttcatctccatgcaggaactcggcaagggtgctcgccgcccggccgga
cagctgaagacggtgctgaagaaagtcggcgtcgtcggtgccggcttcatgggtgcttcc
atcgcctatgtcacggccgcggccggcttgtccgtgacgctgatcgaccgcgatctggaa
gctgccggcaagggcaagagcgtcggcgaaggtctggtgaaggatgctgtcggtaaggga
agaatgacgcaggaagatggcgcggcgctactctcccgcatcacgccgtctgccacctat
gccgatctcagcgatgccgatctcgtcatcgaagcggtcttcgaggatcgcgaagtcaaa
aaagcggtcatcgaggcggtcgaagccgtgctgccggaaggcgccatctttgcctccaac
acctcgacgctgccgatctctggccttgcgaagaactccaagcgtccggccgattttatc
ggcgtccatttcttctctccggtcgagaagatgatgttgaccgaagtcatcctcggcaag
gaaacgggcgaccgcgcccttgccgtggcgctggattacgtcgccgcgatcaagaagacg
ccgatcgtcgtcaacgacactcgtggctttttcgtcaatcgctgcgtcttccgctatatc
catgaagcctatgacatgctgatcgaaggcgtgcccgcgaccatgatcgaaaacgccgcc
aagatggccggcatgccggttggccccctggcactcaacgacgaagtcgctatcgaccta
tcgctgaagatcctcaaggcgaccgtcgccgacctcggcgagaaagcagtcgatccgcgc
cacatgcaactgatcagccgtctcgtggaaggtgagggccgtctgggccgcaagaactcc
aagggcttctatgactacccgccgaagccggctaagaaatcgctgtggctgggcctgaag
gacctctatccgcagaagaaggcggacgagatcgatgtcgccgtcctgaagcagcgcttc
ctcgccaccatcgcgctcgaagccgcccgcaccatggaagagggcatcgtcaccgatccg
cgcgaagccgatgtcggctccatcctcggcttcggcttcgccccctataccggcggcgcg
ctctcctacatcgacggcatgggcgtcaaagccttcgtgagcctttgcgaaacgctggcc
aagacctacggcccgcacttcgcgccgacggcgctgctcaaggatatggcagccaagggc
gagacgttttacggacgatttgatccgtacagcgtgaaagctgcagcctga

DBGET integrated database retrieval system