KEGG   Agrobacterium radiobacter: Arad_0853Help
Entry
Arad_0853         CDS       T00850                                 

Gene name
cheBch1
Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ara  Agrobacterium radiobacter
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ara00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Arad_0853 (cheBch1)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Arad_0853 (cheBch1)
Enzymes [BR:ara01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Arad_0853 (cheBch1)
Two-component system [BR:ara02022]
 CheA family
  CheA-CheYBV
   Arad_0853 (cheBch1)
Bacterial motility proteins [BR:ara02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Arad_0853 (cheBch1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:704762..705805
Genome map
AA seq 347 aa AA seqDB search
MSAPARVLVVDDSPTMRGLITAVLRSDPEVDVIGQAGDALEARAAIKALNPDVVTLDIEM
PNMNGLDFLEKIMTLRPMPVIMVSTMTHRGAEATLAALEIGAFDCVGKPVPGEPRPFGDL
AEKVKAAARSQRQYVKPAASHAPPPAVADFRVGRKIVAIGSSTGGVEALIAVLQKFPANC
PPTVITQHMPPSFTRSFAERLNRLCAPVVQEASDGARLEIGKIYLAPGGERHLQVASSSA
PHCRLVEGGPVNGHRPSVDVLFDSVAELAGRNAVGVILTGMGRDGAAGLLKMRHAGARTI
GQNEKTCVVYGMPRVAFELGAVEQQFPLNAIGEEILKVTAARKEGSE
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcccgcccgcgttctcgtcgtcgacgactcgcccaccatgcgcggcctgatc
accgccgtcctgcgctccgatcctgaggtcgacgtcatcggccaggccggggatgcgctg
gaagcgcgtgccgcgatcaaggcgctcaatcccgacgtcgtgacgctcgatatcgagatg
ccgaacatgaacggcctcgacttcctcgaaaagatcatgacgctgaggcccatgccggtc
atcatggtctcgaccatgacgcatcgcggcgcggaggcgacgctggccgcgctggagatc
ggtgccttcgattgcgtcggcaagccggtgccgggcgagccccgtcccttcggcgatctc
gccgaaaaggtgaaggcggcggcccgttcgcagcggcaatatgtcaagcctgccgccagc
catgccccgccgcccgcggttgccgatttccgtgtcggccgcaagatcgttgcgatcggc
tcctccaccggcggtgtcgaggcgttgatcgcggtgctgcagaaattcccggccaattgc
ccgccgacggtcatcacccagcatatgccgccgagtttcacccgcagtttcgccgagcgt
ctcaaccgtctctgcgcccccgtggtgcaggaggcgagcgacggcgcgcggctggagatc
ggcaagatctatctggcacccggcggtgaaaggcatctgcaggtcgccagctcttcggcg
ccgcattgccggctggtcgagggcgggccggtcaacggccatcgcccttccgtcgatgta
ctgttcgattcggtggccgagcttgccggccgcaacgccgtgggcgtgatcctgaccggc
atggggcgcgatggcgccgcgggtcttctcaagatgcgtcatgccggcgcgcgcactatc
ggccagaacgaaaagacctgcgtggtctatggaatgccgagggtcgcgtttgagctcggt
gcagtcgaacagcagtttccgctgaacgccattggcgaggaaatattgaaagtaacagcc
gcccgaaaggaagggagcgaataa

DBGET integrated database retrieval system