KEGG   Agrobacterium radiobacter K84: Arad_1130Help
Entry
Arad_1130         CDS       T00850                                 

Gene name
ispE
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ara  Agrobacterium radiobacter K84
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ara00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(915903..916817)
Genome map
AA seq 304 aa AA seqDB search
MTMILAAGDFDLTEEAPAKINLALHVTDQRADGYHLLDMLVTFTQHGDRLGFRASERDEF
SLSGRFSPLLAADADAGGNLVLKARDLLRRAAHSAGLEAPPMHIHLEKNLPIASGIGGGS
ADAAATLRGLARLWNLALPLDTMTALALKLGADVPMCLASRPLIARGIGEAIELLPDFPS
FAMVLGNPLVGVSTPEVFRHLARKDNPPLALTSQTSDDHAPWIAAIEGLRNDLEPPARSL
CREIATLSQMIADEGALLTRMSGSGATCFGLFHDLEQATAATASLHRLRPDWYFQATETI
KGDA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaccatgatcttagcggcgggcgatttcgacctcacagaggaagcgcccgccaagatc
aatctggctctgcatgtcaccgaccagcgggccgacggatatcacctgctcgacatgctg
gtgaccttcacgcagcatggtgaccggcttggcttccgtgccagcgagcgcgacgaattc
agcctttccggacgtttctcccctcttcttgccgctgacgcggatgccggcggcaatctg
gtgctgaaggcgcgcgacctgctgcgccgcgccgcccatagtgccgggctggaagcgcca
ccgatgcatatccatctggaaaagaacctgccgattgcctccggcatcggcggtggctcg
gctgacgcggcggcgaccctgcgcggattggcgaggctctggaatcttgccttgcccctg
gacacgatgacggcgctggcgctgaagcttggcgccgatgttccgatgtgccttgccagc
cggccgttgattgcgcgcggcatcggcgaggcgatcgaattgttgccggatttcccgtcc
ttcgccatggtcctcggcaatcccctggtcggcgtttcgacgccagaggtgtttcgccac
cttgcccgcaaggacaatccacctctcgcactcacctcgcaaacgtcggacgatcatgcg
ccatggatcgcggcaatcgaagggttgcgcaacgatctggaaccgccggcgcggtcgctc
tgccgcgaaatcgccacgctgtcgcagatgatcgccgacgaaggagcgcttctgacccgc
atgtccggctccggcgccacctgtttcggcctgtttcatgatcttgagcaggcaactgcg
gcgaccgcatcgcttcacaggctgcggccggactggtatttccaggcgacggaaacaatc
aagggagatgcatga

DBGET integrated database retrieval system